KEGG   Mus musculus (mouse): 22362Help
Entry
22362             CDS       T01002                                 

Gene name
Vpreb1, CD179a, Vpreb-1
Definition
(RefSeq) pre-B lymphocyte gene 1
  KO
K06553  pre-B lymphocyte gene
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    22362 (Vpreb1)
CD molecules [BR:mmu04090]
 Proteins
  22362 (Vpreb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set
Motif
Other DBs
NCBI-GeneID: 22362
NCBI-ProteinID: NP_058678
MGI: 98936
Ensembl: ENSMUSG00000059305
Vega: OTTMUSG00000017055
UniProt: P13372 Q545E0
Position
16 A3; 16 10.46 cM
AA seq 142 aa AA seqDB search
MAWTSVLLMLLAYLTGCGPQPMVHQPPLASSSLGATIRLSCTLSNDHNIGIYSIYWYQQR
PGHPPRFLLRYFSHSDKHQGPDIPPRFSGSKDTTRNLGYLSISELQPEDEAVYYCAVGLR
SQEKKRMEREWEGEKSYTDLGS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcctggacgtctgtcctgctcatgctgctggcctatctcacaggttgtggccctcag
cccatggtgcatcagccaccattagcatcttcttcccttggagccaccatccgcctctcc
tgtaccctgagcaacgaccataacattggcatttacagcatttactggtaccagcagagg
ccgggccaccctcccaggttcctgctgagatacttctcacactcagacaagcaccagggt
cccgatatcccacctcgcttctccgggtccaaagatacgaccaggaacctggggtatctg
agcatctctgaactgcagcctgaggacgaggctgtgtattactgtgccgtggggctccgg
agccaggaaaagaagaggatggagagggagtgggaaggagaaaagtcgtatacagatttg
ggatcttag

DBGET integrated database retrieval system