KEGG   Mus musculus (house mouse): 223626
Entry
223626            CDS       T01002                                 
Symbol
Them6, 4930572J05Rik
Name
(RefSeq) thioesterase superfamily member 6
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: 4HBT_2 4HBT Acyl-ACP_TE
Other DBs
NCBI-GeneID: 223626
NCBI-ProteinID: NP_941009
MGI: 1925301
Ensembl: ENSMUSG00000056665
UniProt: Q80ZW2
Position
15:74593083..74596222
AA seq 207 aa
MLELLVASLSLALAFFALLDGWYLVRVPCAVLRARLLQPRVRDLLAEQRYAGRVLPSDLD
LLLHMNNARYLREADVARAAHLTRCGVLGALRDLNAHTVLAASCARYRRSLRLFEPFEVH
TRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLGTSPDRVVQHLCKRRVEPPELPED
LKHWISYNETSSQLLRAESGLSDRKDQ
NT seq 624 nt   +upstreamnt  +downstreamnt
atgctggagctgttggtggcgtcgttatccctggcgctcgccttctttgcgctgctggac
ggctggtacctggtgcgcgtgccgtgtgctgttctgcgcgcacgcttgctgcagccgcgg
gtccgcgacttattggcggagcagcggtatgccggccgggtgctgccatcggacctggac
ctgctgctacacatgaacaacgcgcgctacctgcgcgaggcggatgtggcgcgcgctgcg
cacctgacccgctgcggtgtgctgggggcgctgcgcgacctgaacgcgcacacggtgctg
gccgcctcgtgcgcgcgctatcgccgctcgctgcgcctgtttgagccgttcgaggtacac
acgcgactgcaaggctgggacgaccgcgccttctacctggaggcgcgttttgtcagcctt
cgcgatggtttcgtgtgcgccttgctgcgtttccgacagcacgtgctgggcacctcgccg
gatcgagtagtacagcacttgtgcaaacggagggtggagccccctgagctgccagaagac
ttgaaacattggatctcctacaatgagaccagcagccagctgctccgtgctgagagcggc
ctcagtgacagaaaggaccagtga

DBGET integrated database retrieval system