KEGG   Mus musculus (mouse): 22363
Entry
22363             CDS       T01002                                 

Gene name
Vpreb2, CD179b, Vpre, VpreB1, Vpreb-2
Definition
(RefSeq) pre-B lymphocyte gene 2
  KO
K06553  pre-B lymphocyte gene
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    22363 (Vpreb2)
CD molecules [BR:mmu04090]
 Proteins
  22363 (Vpreb2)
SSDB
Motif
Pfam: V-set Ig_3 I-set
Other DBs
NCBI-GeneID: 22363
NCBI-ProteinID: NP_058679
MGI: 98937
Ensembl: ENSMUSG00000059280
UniProt: P13373
Position
16 A3; 16 11.14 cM
AA seq 142 aa
MAWTSVLLMLLAHLTGCGPQPMVHQPPSASSSLGATIRLSCTLSNDHNIGIYSIYWYQQR
PGHPPRFLLRYFSHSDKHQGPDIPPRFSGSKDTARNLGYLSISELQPEDEAVYYCAVGLR
SHEKKRMEREWEGEKSYTDLGS
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcctggacgtctgtcctgctcatgctgctggcccacctcacaggttgtggccctcag
cccatggtgcatcagccaccatcagcatcttcttcccttggagccaccatccgcctctcc
tgtaccctgagcaacgaccataacattggcatttacagcatttactggtaccagcagagg
ccgggccaccctcccaggttcctgctgagatacttctcacactcagacaagcaccagggt
cccgatatcccacctcgcttctccgggtccaaagatacggccaggaacctggggtatctg
agcatctctgaactgcagcctgaggacgaggctgtgtattactgcgctgtggggctccgg
agccacgaaaagaagagaatggagagagagtgggaaggagaaaagtcgtatacagatttg
ggatcttag

DBGET integrated database retrieval system