KEGG   Mus musculus (house mouse): 223642
Entry
223642            CDS       T01002                                 
Symbol
Zc3h3, BC049953, Kiaa0150, Smicl, Zc3hdc3
Name
(RefSeq) zinc finger CCCH type containing 3
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-CCCH Torus zf_CCCH_4 zf-CCCH_3
Other DBs
NCBI-GeneID: 223642
NCBI-ProteinID: NP_742119
MGI: 2663721
Ensembl: ENSMUSG00000075600
UniProt: Q8CHP0 Q3UUL4
Position
15:complement(75626279..75713910)
AA seq 950 aa
MEEKEQLRRQIRLLQGLIDDYKTLHGNGPALGNSSATRWQPPMFPGGRTFGARYSRPSRR
GFSSHHGPSWRKKYSLVNQPVESSDPASDPAFQTSLRSEDSQHPEPQQYVLERQVQLSPD
QNMVIKIKPPSKSGAINASGVQRGSLEGCDDPSWSGQRPQGSEVEVPGGQLQPARPGRTK
VGYSVDDPLLVCQKEPGKPRVVKSVGRVSDSSPEHRRTVSENEVALRVHFPSVLPHHTAV
ALGRKVGPHSTSYSEQFIGDQRANTGHSDQPASLGPVVASVRPATARQVREASLLVSCRT
SKFRKNNYKWVAASEKSPRVARRALSPRTTLESGNKATLGTVGKTEKPQPKVDPEVRPEK
LATPSKPGLSPSKYKWKASSPSASSSSSFRWQSEAGSKDHTSQLSPVPSRPTSGDRPAGG
PSSLKPLFGESQLSAYKVKSRTKIIRRRGNTSIPGDKKNSPTTATTSKNHLTQRRRQALR
GKNSPVLRKTPHKGLMQVNRHRLCCLPSSRTHLSTKEASSVHMGIPPSNKVIKTRYRIVK
KTPSSSFGAPSFPSSLPSWRARRIPLSRSLVLNRLRPAITGGGKAPPGTPRWRNKGYRCI
GGVLYKVSANKLSKTSSRPSDGNRTLLRTGRLDPATTCSRSLASRAIQRSLAIIRQAKQK
KEKKREYCMYYNRFGRCNRGECCPYIHDPEKVAVCTRFVRGTCKKTDGSCPFSHHVSKEK
MPVCSYFLKGICSNSNCPYSHVYVSRKAEVCSDFLKGYCPLGAKCKKKHTLLCPDFARRG
ICPRGSQCQLLHRNQKRHGRRTAAPPIPGPSDGAPRSKASAGHVLRKPTTTQRSVRQMSS
GLASGAEAPASPPPSPRVLASTSTLSSKATAASSPSPSPSTSSPAPSLEQEEAVSGTGSG
TGSSGLCKLPSFISLHSSPSPGGQTETGPQAPRSPRTKDSGKPLHIKPRL
NT seq 2853 nt   +upstreamnt  +downstreamnt
atggaggaaaaggagcagctgcggcggcagatacgcctcctgcagggtctaattgatgac
tataaaacactccacggcaatggccctgccctgggcaactcatcagctactcggtggcag
ccacccatgttcccgggtggcaggacctttggcgcccgctactcccgtccaagtcggagg
ggcttctcctcacaccatggcccttcgtggcgcaagaaatactcccttgtgaatcagcct
gtggaatcttctgacccagccagcgatcctgcttttcagacatccctcaggtctgaggat
agccagcatcctgaaccccagcagtatgtactggagagacaggtccagctcagtccagat
cagaatatggttattaagatcaagccaccatcaaagtcaggtgccatcaatgcttcaggg
gtccagcgggggtccttggaaggctgtgatgacccctcttggagtggccaaagaccccaa
ggaagtgaggttgaggtccctggtggacaactgcagcctgcaaggccaggaagaaccaag
gtgggttacagtgtggacgaccccctcttggtctgccagaaggagcctggcaagcctcgg
gtagtgaagtctgtgggcagggtgagtgacagctctcccgagcatcggcggacagtcagt
gaaaatgaagtggccctcagggtacacttcccatctgtcctgccccatcacactgctgtg
gctctgggcaggaaggtaggccctcattctaccagctattctgaacagttcattggagac
caaagagcaaacactggccactcagaccagccagcttccttggggccagtggtggcttca
gtcagaccagcaacagccaggcaggtcagggaggcctcactgctcgtgtcctgtcgaacc
agcaagtttcggaaaaacaactacaaatgggtagctgcctcagaaaagagcccacgggtc
gctcggagagccctcagtcccagaacaactctggagagcgggaacaaggccactttgggt
acagttggaaagacagagaagccacagcctaaagttgacccagaggtgaggccggagaaa
ctggccacaccatccaagcctggcctctctcccagcaagtacaagtggaaggcttccagc
ccgtctgcttcctcctcttcctctttccgttggcagtctgaggctggcagcaaggaccat
acttctcagctctccccagtcccatctaggcccacatcaggggacagaccagcaggggga
cccagcagcttgaagcccctctttggagagtcacagctctcagcttacaaagtgaagagc
cggaccaagattatccggaggcggggcaataccagcattcctggggacaagaagaacagc
cctacaactgccaccaccagcaaaaaccatcttacccagcgacggagacaggccctccgg
gggaagaatagcccggttctaaggaagactccccacaagggtctgatgcaggtcaacagg
caccggctctgctgcctgccgtccagccggacccacctctccaccaaggaagcttccagt
gtgcacatggggattccaccctccaataaggtgatcaagacccgctaccgcattgttaag
aagaccccaagctcttcctttggtgctccatccttcccctcatctctaccctcctggcgg
gcccggcgcatcccattatccaggtccctagtgctaaaccgccttcgtccagcaatcact
gggggagggaaagccccacctggtacccctcgatggcgcaacaaaggctaccgctgcatt
ggaggggttctgtacaaggtgtctgccaacaagctctccaaaacttctagcaggcccagt
gatggcaacaggaccctcctccgcacaggacgcctggaccctgctaccacctgcagtcgt
tccttggccagccgggccatccagcggagcctggctatcatccggcaggcgaagcagaag
aaagagaagaagagagagtactgcatgtactacaaccgctttggcaggtgtaaccgtggc
gaatgctgcccctacatccatgaccctgagaaggtggccgtgtgcaccagatttgtccga
ggcacatgcaagaagacagatgggtcctgccctttctctcaccatgtgtccaaggaaaag
atgcctgtgtgctcctactttctgaaggggatctgcagcaacagcaactgcccctacagc
catgtgtacgtgtcccgcaaggctgaagtctgcagtgacttcctcaaaggctactgccca
ttgggtgcaaagtgcaagaagaagcacacgctgctgtgtcctgactttgcccgcaggggt
atttgtccccgtggctcccagtgccagctgctccatcgtaaccagaagcgacatggccgg
cggacagctgcacctcctatccctgggcccagtgatggagcccccagaagcaaggcctca
gctggccacgtactcaggaagcctactactactcagcgctctgtcagacagatgtccagt
ggtctggcttccggagctgaggccccagcctccccacctccctccccaagggtattagcc
tccacctctaccctgtcttcaaaggccaccgctgcctcctctccttccccctctccctct
actagctccccagccccttccttggagcaggaagaagctgtctctgggacaggctcagga
acaggctccagtggcctctgcaagctgccatccttcatctccctgcactcctccccaagc
ccaggaggacagactgagactgggccccaggcccccaggagccctcgcaccaaggactca
gggaagccgctacacatcaaaccacgcctgtga

DBGET integrated database retrieval system