KEGG   Mus musculus (mouse): 223646Help
Entry
223646            CDS       T01002                                 

Gene name
Naprt, 9130210N20Rik, Naprt1
Definition
(RefSeq) nicotinate phosphoribosyltransferase
  KO
K00763  nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00760  Nicotinate and nicotinamide metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    223646 (Naprt)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     223646 (Naprt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAPRTase
Motif
Other DBs
NCBI-GeneID: 223646
NCBI-ProteinID: NP_766195
MGI: 2442664
Ensembl: ENSMUSG00000022574
UniProt: Q8CC86
Position
15; 15 D3
AA seq 538 aa AA seqDB search
MEMELDSEGRMVVRPLLTDLYQATMALGYWRAGRACEAAEFELFFRHCPFGGSFALSAGL
QDCMRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSGVTVRALPEGSLAFPGVP
LLQVSGPLLLVQLLETPLLCLVSYASLVATNAARLRLIAGPDKKLLEMGLRRAQGPDGGF
TASIYSYLGGFDSSSNTLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPASSEGPTV
DLPARVNLWLKRVCLYLGLEEQEPHPGERAAFVAYALAFPRAFQGLLDSYSVRRSGLPNF
LAVALALGELGYRAVGVRLDSGDLLQQAKEIRGIFRTAGAQFQMPWLESVPIAVSNNIDE
SELMRLAQKGSEVNVIGIGTSVVTCPKQPSMGCVYKLVSVGGQPRIKLTEDPEKQTLPGS
KAAFRFLGPDGSLLLDLLQLAEEPPPKAGQELRVWPRGTQEPCTVKPAQVEPLLRLYLQQ
GQLCEPLPSLDESRRFAQQSLSLLRPAHKQLQSPAVYPVALSEKLRALVDSLSARGPL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagctggacagcgaggggcgcatggtggtgcggccgctgctcaccgacctc
tatcaggctaccatggcgctgggctactggcgtgcgggccgggcgtgcgaggcagcagag
ttcgagctcttcttccgccactgccctttcggaggctccttcgccctttccgctggcttg
caggactgtatgcgctttcttcgcgccttccgtctgcgggatgcagatgtgcagttcctg
gcttcggtactacccccagacactgaccctgcgttcttcgagcaccttcgagcccttgat
tgctctggggtgaccgtgcgggctctgccagagggttccctcgccttccctggtgtgccg
cttctgcaggtgtccgggcctcttcttctggtacagctgctagagactccactgctgtgt
ctggtcagctacgctagcctcgtagccaccaatgctgctcggctacgcttgattgcaggg
ccggataagaaactactagagatgggtttgcggcgagctcagggtcccgacgggggtttc
acggcctcaatttacagctacctgggtggctttgacagcagcagcaacacacttgctgga
caactgagaggtgtaccggtggcagggaccctggcccactcctttgtcacttcattttcg
ggtagtgaggtaccccccgacccgatgttggctccagcttctagtgagggccccacagtg
gacctgcctgccagggtaaatttgtggctgaagcgtgtgtgcctctacttggggctagag
gagcaggagccacacccaggggagcgcgcagcatttgtggcctatgctctggcctttccc
cgggctttccagggcctgctagattcctacagtgtacgcaggagtggccttcctaacttc
ctggcagtagccctggcactgggggagcttggctacagagcagtgggtgtgaggctggac
agcggtgacctgcttcagcaggctaaagagatccgtggcatctttcgaactgctggtgcc
caattccagatgccctggctagagtctgttcccattgcagtcagcaacaacattgacgag
agtgagctgatgaggctagcccagaagggcagtgaggtgaatgtcattggcattggcacc
agtgtggtcacttgtcccaaacagccttctatgggctgtgtctacaagctggtgtctgta
ggaggccagcctcgaatcaagctgacagaggaccctgagaagcaaacactgccagggagc
aaggctgccttccggttcctaggccccgatgggtctttgctactggacctactgcagtta
gcagaagagcccccgcccaaggctgggcaggaactgagggtttggcctcgggggacccag
gagccctgcactgtgaagccagcccaagtggagccattgctgcgactctacctgcaacag
ggacagctgtgtgagccactgccatctctggatgagtccagacgctttgcccagcagtcc
ctgagcctcctccgccctgcacataagcagctgcagagccctgcagtgtatccggtcgca
ctgtcagagaagcttcgggcactggtggacagtttgagtgctcgaggtcccctgtga

DBGET integrated database retrieval system