KEGG   Mus musculus (house mouse): 22367
Entry
22367             CDS       T01002                                 
Symbol
Vrk1, 51PK
Name
(RefSeq) vaccinia related kinase 1
  KO
K08816  vaccinia related kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    22367 (Vrk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     22367 (Vrk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  VRK family
   22367 (Vrk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like Pox_ser-thr_kin TCAD9 EcKL RIO1
Other DBs
NCBI-GeneID: 22367
NCBI-ProteinID: NP_035835
MGI: 1261847
Ensembl: ENSMUSG00000021115
UniProt: Q80X41
Position
12:105976398..106044578
AA seq 440 aa
MPRVKAAQAGRPGPAKRRLAEQFAAGEVLTDMSRKEWKLGLPIGQGGFGCIYLADTNSSK
PVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTHKLKYLGVPKYWGSGLHD
KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA
SNLLLSHKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHDGTLEFTSIDAHKGVAPSR
RGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEKCFPEKNKPGEIA
KYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKK
EAEESAVCAVEDMECSDTQVQEAAQTRSVESQGAIHGSMSQPAAGCSSSDSSRRQQHLGL
EQDMLRLDRRGSRTRKKAQK
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgccccgtgtaaaagcagctcaggctggaagacccggacctgcgaagaggcgcctcgca
gagcagtttgccgctggagaggtcctaaccgacatgtctaggaaggagtggaaactagga
ttgcccattggccaaggtggctttggctgcatctatctggcggacacaaattcttccaaa
ccggttggcagtgacgcgccctgtgttgtgaaagtggaacccagtgacaatggacctctt
ttcacggaattaaagttctaccagagggctgctaaaccagagcaaattcagaaatggatt
cgtacacataaattgaagtaccttggtgttcctaagtattggggatctggtctacatgat
aaaaatggaaaaagttacaggtttatgataatggaccgctttgggagtgaccttcagaaa
atatatgaagcaaatgccaaaaggttttctcggaaaactgtattgcagctaagcttaaga
attctggatatcctggagtacatccatgagcatgagtacgtgcacggggacatcaaggcc
tccaacctgctcctgagtcacaagaaccctgaccaggtatatttggtagactatggcctt
gcttatcggtactgcccagatggagttcataaagagtacaaggaagatcccaaaaggtgc
catgacggcaccctggagttcaccagcatcgacgctcacaaaggcgtggccccatcaaga
cgtggtgatttggaaatacttggttattgcatgatccagtggctcagcggctgtcttcct
tgggaagataacttgaaagatcctaactacgttagggattccaaaattagatacagagac
aacgtcgcagctttgatggagaaatgctttcctgagaaaaataagccaggtgagatcgct
aagtacatggagtctgtgaaactactggaatacaccgaaaaacctctctatcaaaaccta
cgtgatatccttttacaaggactaaaagctataggaagtaaagacgacggcaaactggat
tttagtgctgtggagaacggaagtgtgaagacaagaccagcctcaaagaagcggaagaaa
gaagcagaagaaagcgcggtgtgcgctgtggaggacatggagtgctcagacacacaggtg
caagaggccgcacagacccgaagtgtggagtcccaaggagcaatacatggaagcatgtct
cagccagcggcgggctgcagcagctctgacagttccaggaggcagcagcatttgggattg
gaacaagacatgctaaggctagaccgtaggggttcacgaaccagaaagaaagcccagaag
taa

DBGET integrated database retrieval system