KEGG   Mus musculus (house mouse): 22368
Entry
22368             CDS       T01002                                 
Symbol
Trpv2, GRC, OTRPC2, VRL-1, Vrl1
Name
(RefSeq) transient receptor potential cation channel, subfamily V, member 2
  KO
K04971  transient receptor potential cation channel subfamily V member 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22368 (Trpv2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    22368 (Trpv2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    22368 (Trpv2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   22368 (Trpv2)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 22368
NCBI-ProteinID: NP_035836
MGI: 1341836
Ensembl: ENSMUSG00000018507
UniProt: Q9WTR1
Position
11:62465312..62491131
AA seq 756 aa
MTSASNPPAFRLETSDGDEEGSAEVNKGKNEPPPMESPFQGEDRNFSPQIKVNLNYRKGL
GPSQQDPNRFDRDRLFSVVSRGVPEELTGLLEYLRRTSKYLTDSAYTEGSTGKTCLMKAV
LNLQDGVNACILPLLQIDRDSGNPQPLVNAQCTDEFYRGHSALHIAIEKRSLWCVKLLVE
NGANVHIRACGRFFQKHQGTCFYFGELPLSLAACTKQWDVVTYLLENPHQPASLEATDSL
GNTVLHALVMIADNSPENSALVIHMYDSLLQMGARLCPTVQLEDICNHQGLTPLKLAAKE
GKIEIFRHILQREFSGLYQPLSRKFTEWCYGPVRVSLYDLSSVDSWEKNSVLEIIAFHCK
SPHRHRMVVLEPLNKLLQEKWDRLIPRFFFNFACYLVYMIIFTIVAYHQPSLEQPAIPSS
KATFGDSMLLLGHILILLGGIYLLLGQLWYFWRRRLFIWISFMDSYFEILFLVQALLTVL
SQVLRFVETEWYLPLLVSSLVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLLVYL
VFLFGFAVALVSLSREARSPKAPEDSNTTVTEKPTLGQEEEPVPYGGILDASLELFKFTI
GMGELAFQEQLRFRGVVLLLLLAYVLLTYVLLLNMLIALMSETVNSVATDSWSIWKLQKA
ISVLEMENGYWWCRRKRHRAGRLLKVGTKGDGIPDERWCFRVEEVNWAAWEKTLPTLSED
PSGAGITGYKKNPTSKPGKNSASEEDHLPLQVLQSH
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgacttcagcctccaaccccccagcttttaggctggagacgtccgatggagatgaagaa
ggcagtgctgaggtgaacaaaggaaagaatgagccaccccccatggagtctcccttccag
ggagaggaccggaacttctcccctcagattaaagtgaatctcaactaccgaaagggactg
ggtcccagccaacaggacccaaatcggtttgaccgtgaccgactcttcagtgtggtctcc
cggggtgtccccgaggagctgactggactgctagagtacctgcgccggaccagcaagtac
ctcactgactcggcatacacagaaggctccactggaaagacgtgcctgatgaaggctgtg
ctgaaccttcaggatggggtcaatgcctgtatcctgccgctgctgcagattgacagggat
tccggcaatcctcagccccttgtcaatgcccagtgcaccgatgagttctaccgaggccac
agtgcgctgcacatcgccatagagaagaggagcctgtggtgcgtgaagctgctggtagag
aatggagcgaatgttcacatccgagcctgtggccgcttcttccaaaagcaccaaggaact
tgtttctattttggagagctacctctttctctggcagcgtgcaccaagcagtgggatgtg
gtgacctacctcctggagaacccacaccagcctgccagcctggaggccaccgactccctg
ggcaacacagtcctgcatgctctggtaatgattgcagacaactcacctgagaacagtgcg
ctggtgatccacatgtatgacagccttctccaaatgggggcccgcctctgccccactgta
cagcttgaggatatctgcaaccatcaaggcctcacacccctgaagttggctgccaaggaa
ggtaaaattgagatcttcaggcacatcctgcagcgggagttctcagggctgtaccagccc
ctttcccgaaagttcaccgagtggtgctacggtcctgtccgagtgtcactgtacgacctg
tcctctgtggacagttgggaaaagaactcggtcctggaaatcatcgctttccattgcaag
agcccgcaccggcaccgcatggtggttttagagccactgaacaagcttctgcaggagaaa
tgggatcggctcatcccaagattcttcttcaacttcgcctgttacttggtctacatgatc
atcttcaccatagttgcctaccaccagccttccctggagcagccagccattccctcatca
aaagcgacttttggggactccatgctgctgttgggccacattctgatcctgcttgggggt
atttacctcttactgggccagctgtggtacttttggcggcggcgcctgttcatctggatc
tcgttcatggacagttactttgaaatcctcttccttgtccaggcgctgctcacagtgctg
tcccaggtgctgcgcttcgtggagactgaatggtacctccccctgttagtgtcatcccta
gtgctgggctggctgaacctgctttattatacacgtggctttcagcacacaggcatctac
agtgtcatgatccaaaaggtcattctgcgagacctgctccgcttcctgctggtctaccta
gtcttccttttcggctttgctgtagccctagtaagcttgagccgggaggcccgaagtccc
aaagcccctgaagatagcaacaccactgtgacggaaaagcccacgctgggtcaggaggag
gagccagtcccatatgggggcattctggatgcctccctagagctgttcaagttcaccatt
ggtatgggtgagctggctttccaggaacagctgcgctttcgtggggtggtgctgctgttg
ctgttggcctacgtcctcctcacctacgtcctactgctcaacatgctcattgccctcatg
agtgagactgtcaacagcgttgccactgacagctggagcatctggaagttgcagaaagcc
atctctgtcttggagatggagaatggttactggtggtgcaggaggaaaaggcatcgcgca
gggaggctgctgaaagttggcaccaaaggggatggtatacctgatgagcgctggtgcttc
agggtggaggaagtaaactgggctgcatgggagaagacccttcccaccttatctgaggat
ccatcaggggcaggcatcactggttataaaaagaacccaacctctaaacctgggaagaac
agtgcctcagaggaagaccatctgcctcttcaggtcctccagtcccactga

DBGET integrated database retrieval system