KEGG   Mus musculus (house mouse): 223691
Entry
223691            CDS       T01002                                 
Symbol
Eif3l, 0610011H21Rik, D15N1e, Eif3eip, Eif3ip, Eif3s6ip, HSP-66Y, PAF67
Name
(RefSeq) eukaryotic translation initiation factor 3, subunit L
  KO
K15029  translation initiation factor 3 subunit L
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    223691 (Eif3l)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    223691 (Eif3l)
SSDB
Motif
Pfam: Paf67 TPR_2 TPR_1 ANAPC3
Other DBs
NCBI-GeneID: 223691
NCBI-ProteinID: NP_660121
MGI: 2386251
Ensembl: ENSMUSG00000033047
UniProt: Q8QZY1
Position
15:78959423..78978600
AA seq 564 aa
MSYPADDYESEAAYDPYAYPGDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFH
KTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAP
QVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPN
QWLWDIIDEFIYQFQSFSQYRCKTAKKSEGEMDFLRSNPKVWNVHSVLNVLHSLVDKSNI
NRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELN
KKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMI
NKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYACPKF
LSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLD
LTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYG
DFFIRQIHKFEELNRTLKKMGQRP
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgtcttaccccgctgatgactacgagtctgaggctgcttatgatccctacgcctacccg
ggcgactatgatatgcacacaggagatccgaagcaggaccttgcctatgagcggcagtat
gagcagcagacatatcaggtgataccggaagtgatcaaaaacttcatccagtacttccac
aagactgtctccgatttgattgaccagaaggtgtacgagcttcaggccagccgcgtctcg
agtgatgtcattgaccagaaggtgtacgagatccaggacatttacgagaacagctggacc
aagctaactgaaaggttcttcaagaatacaccgtggcctgaggcagaagcaattgcaccc
caagttggcaatgatgccgtattcctaattttgtacaaagaattgtactacaggcatatt
tacgccaaagtcagtgggggtccctccttagaacagaggttcgaatcttattacaactac
tgcaatctcttcaactacatcctcaatgcggatggacctgcgccccttgaactccccaac
cagtggctctgggacatcatcgatgagttcatctaccagttccagtcattcagtcagtac
cgctgcaagacggccaagaagtcagagggagagatggacttccttaggtccaaccctaaa
gtctggaacgtgcacagcgtcctcaacgtgctgcactccctggtggacaagtccaacatc
aaccggcagctggaggtctacaccagcggaggtgacccggaaagtgtagctggggagtat
ggacgacactccctctacaagatgctcggctacttcagcctggtggggcttctgcgcctg
cattctctactgggggattactaccaggctatcaaggtgctggagaatatcgagctgaac
aagaaaagcatgtattcccgtgtgcctgagtgccaggtcaccacctactattatgttggc
tttgcgtatttaatgatgcgtcgatatcaggatgctatccgagtctttgccaacatcctc
ctgtacatccagaggaccaagagtatgttccagaggaccacatacaaatatgaaatgatt
aacaagcagaacgagcagatgcatgctctgctggccattgctctcaccatgtacccgatg
cggatcgacgagagcatacacctccagctgcgggagaaatacggggacaagatgctgcgc
atgcagaagggggacccccaggtctatgaggaacttttcagctatgcctgccccaagttc
ctgtcgcctgtggtgccaaactacgacaatgtccatcctaactaccacaaagagcccttc
ctgcagcagctgaaggtgttttccgatgaggtgcagcagcaggcccagctctccaccatc
cgcagcttcctcaagctctacaccaccatgcctgtggccaagctggccggcttcctggac
ctcaccgagcaggagttccgcatccagctgctcgtcttcaagcacaagatgaagaatctg
gtgtggaccagtggcatttctgccctagatggcgaattccagtcggcctcggaggtggac
ttctatattgataaggacatgatccatattgcagacaccaaagttgccagacgctatggg
gatttctttatccgacagatccacaagtttgaagagcttaatcgaaccctgaagaagatg
ggacagaggccctga

DBGET integrated database retrieval system