KEGG   Mus musculus (mouse): 223693
Entry
223693            CDS       T01002                                 

Gene name
Tmem184b, 2610507A11, 4732495E13Rik
Definition
(RefSeq) transmembrane protein 184b
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Solute_trans_a
Other DBs
NCBI-GeneID: 223693
NCBI-ProteinID: NP_001240746
MGI: 2445179
Ensembl: ENSMUSG00000009035
UniProt: Q8BG09
Position
15; 15 E1
AA seq 407 aa
MTVRGAALAPDPASPTTTTASPSVSATPEGSPTAMEHPVFLMTTAAQAISGFFVWTALLI
TCHQIYMHLRCYSRPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEA
FVIYNFLSLCYEYLGGESAIMSEIRGKAIESSCMYGTCCLWGKTYSIGFLRFCKQATLQF
CVVKPLMAVSTVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELL
SPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKINSARVSVGEGTVAAGYQDFIIC
VEMFFAALALRHAFTYKVYADKRLDAQGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPA
YQQYTQQSTLEPGPTWRGGTHSLSRSHSLSGARDNEKTLLLSSDDEF
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgacagtgaggggggccgcgctggccccagacccagcgtcacccacaaccacaacagct
tcacctagcgtctctgccacccccgagggcagccccacagccatggagcaccctgtgttc
ctgatgaccactgccgcccaggccatctccggcttctttgtgtggacagctctgctcatc
acttgccaccagatctacatgcatctgcgctgctacagccgtcccaatgagcagcgccac
atcgtgcgcatcctcttcatcgtgcccatctacgccttcgactcctggctcagcctcctc
ttcttcaccaatgaccagtactacgtgtacttcggcaccgtccgagactgctatgaggcc
tttgtcatctataacttcctgagcttgtgctatgagtacctcgggggagagagtgccatc
atgtctgagatcagagggaaggccattgagtccagctgtatgtacggcacgtgctgcctc
tggggaaagacctactccatcggattcctgcggttctgtaaacaggccaccctgcagttc
tgtgtggtgaagccactcatggccgtcagcaccgttatactccaggcctttggcaagtac
cgggacggagactttgatgtcaccagtgggtacctctacgtgaccatcatctacaacatc
tccgtcagcctggccctatatgcgctcttcctcttctactttgccacaagggagctgctc
agcccctacagccctgtcctcaagttcttcatggtcaagtccgtcatattcctctccttc
tggcaaggcatgctgctggccatcttagagaagtgcggggccatccccaagatcaactca
gcgcgagtgtcagtgggtgagggcaccgtggctgccggctaccaggacttcatcatctgt
gtggagatgttcttcgcggccttggccctgcggcatgccttcacctacaaggtctacgct
gacaagagactggacgctcaaggccgctgcgcccccatgaagagcatctccagcagcctc
aaagagaccatgaacccacacgatattgtgcaggacgccatccacaacttctcgccagcc
taccagcagtacacgcagcagtccactctggagcccgggcccacctggcgtggcggcacg
cacagcctttcccgctcccacagccttagtggtgcacgcgacaatgagaagactctgctg
ctcagctctgatgatgagttctaa

DBGET integrated database retrieval system