KEGG   Mus musculus (mouse): 22370
Entry
22370             CDS       T01002                                 

Gene name
Vtn, AI256434, Vn
Definition
(RefSeq) vitronectin
  KO
K06251  vitronectin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04610  Complement and coagulation cascades
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    22370 (Vtn)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    22370 (Vtn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22370 (Vtn)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    22370 (Vtn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    22370 (Vtn)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    22370 (Vtn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22370 (Vtn)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22370 (Vtn)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22370 (Vtn)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   22370 (Vtn)
SSDB
Motif
Pfam: Hemopexin Somatomedin_B
Other DBs
NCBI-GeneID: 22370
NCBI-ProteinID: NP_035837
MGI: 98940
Ensembl: ENSMUSG00000017344
Vega: OTTMUSG00000000143
UniProt: P29788
Position
11 B5; 11 46.74 cM
AA seq 478 aa
MAPLRPFFILALVAWVSLADQESCKGRCTQGFMASKKCQCDELCTYYQSCCADYMEQCKP
QVTRGDVFTMPEDDYWSYDYVEEPKNNTNTGVQPENTSPPGDLNPRTDGTLKPTAFLDPE
EQPSTPAPKVEQQEEILRPDTTDQGTPEFPEEELCSGKPFDAFTDLKNGSLFAFRGQYCY
ELDETAVRPGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPGYPR
NISEGFSGIPDNVDAAFALPAHRYSGRERVYFFKGKQYWEYEFQQQPSQEECEGSSLSAV
FEHFALLQRDSWENIFELLFWGRSSDGAREPQFISRNWHGVPGKVDAAMAGRIYVTGSLS
HSAQAKKQKSKRRSRKRYRSRRGRGHRRSQSSNSRRSSRSIWFSLFSSEESGLGTYNNYD
YDMDWLVPATCEPIQSVYFFSGDKYYRVNLRTRRVDSVNPPYPRSIAQYWLGCPTSEK
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcacccctgaggccctttttcatactagccctggtggcatgggtttctctggctgac
caagagtcatgcaagggccgctgcactcagggtttcatggccagcaagaagtgtcagtgt
gacgagctttgcacttactatcagagctgctgtgccgactacatggagcagtgcaagccc
caagtaacgcggggggacgtgttcactatgccagaggatgattattggagctatgactac
gtggaggagcccaagaacaataccaacaccggtgtgcaacccgagaacacctctccaccc
ggtgacctaaatcctcggacggacggcactctaaagccgacagccttcctagatcctgag
gaacagccaagcaccccagcgcctaaagtggagcaacaggaggagatcctaaggcccgac
accactgatcaagggacccctgagtttccagaggaagaactgtgcagtggaaagcccttt
gacgccttcacggatctcaagaatgggtccctctttgccttccgagggcagtactgctat
gagctagatgagacggcagtgaggcctgggtaccccaaacttatccaagatgtctggggc
attgagggccccatcgatgctgccttcactcgcatcaactgtcaggggaagacctacttg
ttcaagggtagtcagtactggcgctttgaggatggggtcctggaccctggttatccccga
aacatctccgaaggcttcagtggcataccagacaatgttgatgcagcgttcgcccttcct
gcccaccgttacagtggccgggaaagggtctacttcttcaaggggaagcagtactgggag
tacgaatttcagcagcaacccagccaggaggagtgcgaaggcagctctctgtcagccgtg
tttgagcactttgccttgcttcagcgggacagctgggagaacattttcgaactcctcttc
tggggcagatcctctgatggagccagagaaccccaattcatcagccggaactggcatggt
gtgccagggaaagtggacgctgctatggccggccgcatctacgtcactggctccttatcc
cactctgcccaagccaaaaaacagaagtctaagcgtagaagccgaaagcgctatcgttca
cgccgagggcgtggccacagacgcagccagagctcgaactcccgtcgttcatcacgttca
atctggttctctttgttctccagcgaggagagtgggctaggaacctacaacaactatgat
tatgatatggactggcttgtacctgccacctgcgagcccattcagagcgtctatttcttc
tctggagacaaatactaccgagtcaaccttagaacccggcgagtggactctgtgaatcct
ccctacccacgctccattgctcagtattggctgggctgcccgacctctgagaagtag

DBGET integrated database retrieval system