KEGG   Mus musculus (mouse): 22371
Entry
22371             CDS       T01002                                 

Gene name
Vwf, 6820430P06Rik, AI551257, B130011O06Rik, C630030D09, F8VWF, VWD
Definition
(RefSeq) Von Willebrand factor
  KO
K03900  von Willebrand factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu05165  Human papillomavirus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    22371 (Vwf)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    22371 (Vwf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22371 (Vwf)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    22371 (Vwf)
   04611 Platelet activation
    22371 (Vwf)
   04613 Neutrophil extracellular trap formation
    22371 (Vwf)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    22371 (Vwf)
   05165 Human papillomavirus infection
    22371 (Vwf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    22371 (Vwf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22371 (Vwf)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Others
   22371 (Vwf)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22371 (Vwf)
SSDB
Motif
Pfam: VWD VWA C8 VWA_N2 TIL VWA_2 VWC Pacifastin_I
Other DBs
NCBI-GeneID: 22371
NCBI-ProteinID: NP_035838
MGI: 98941
Ensembl: ENSMUSG00000001930
Vega: OTTMUSG00000022190
UniProt: Q8CIZ8 E9QPU1
Structure
PDB: 
1U0O

Position
6 F3; 6 59.32 cM
AA seq 2813 aa
MNPFRYEICLLVLALTWPGTLCTEKPRDRPSTARCSLFGDDFINTFDETMYSFAGGCSYL
LAGDCQKRSFSILGNFQDGKRMSLSVYLGEFFDIHLFANGTVTQGDQSISMPYASQGLYL
EREAGYYKLSSETFGFAARIDGNGNFQVLMSDRHFNKTCGLCGDFNIFAEDDFRTQEGTL
TSDPYDFANSWALSSEEQRCKRASPPSRNCESSSGDMHQAMWEQCQLLKTASVFARCHPL
VDPESFVALCEKILCTCATGPECACPVLLEYARTCAQEGMVLYGWTDHSACRPACPAGME
YKECVSPCPRTCQSLSINEVCQQQCVDGCSCPEGELLDEDRCVQSSDCPCVHAGKRYPPG
TSLSQDCNTCICRNSLWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCED
HTFSIVIETMQCADDPDAVCTRSVSVRLSALHNSLVKLKHGGAVGIDGQDVQLPFLQGDL
RIQHTVMASVRLSYAEDLQMDWDGRGRLLVKLSPVYSGKTCGLCGNYNGNKGDDFLTPAG
LVEPLVVDFGNAWKLQGDCSDLRRQHSDPCSLNPRLTRFAEEACALLTSSKFEACHHAVS
PLPYLQNCRYDVCSCSDSRDCLCNAVANYAAECARKGVHIGWREPGFCALGCPQGQVYLQ
CGNSCNLTCRSLSLPDEECSEVCLEGCYCPPGLYQDERGDCVPKAQCPCYYDGELFQPAD
IFSDHHTMCYCEDGFMHCTTSGTLGSLLPDTVLSSPLSHRSKRSLSCRPPMVKLVCPADN
PRAQGLECAKTCQNYDLECMSLGCVSGCLCPPGMVRHENKCVALERCPCFHQGAEYAPGD
TVKIGCNTCVCRERKWNCTNHVCDATCSAIGMAHYLTFDGLKYLFPGECQYVLVQDYCGS
NPGTFQILVGNEGCSYPSVKCRKRVTILVDGGELELFDGEVNVKRPLRDESHFEVVESGR
YVILLLGQALSVVWDHHLSISVVLKHTYQEQVCGLCGNFDGIQNNDFTTSSLQVEEDPVN
FGNSWKVSSQCADTRKLSLDVSPATCHNNIMKQTMVDSACRILTSDVFQGCNRLVDPEPY
LDICIYDTCSCESIGDCACFCDTIAAYAHVCAQHGQVVAWRTPTLCPQSCEEKNVRENGY
ECEWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGRILDELLQTCVDPQDCPVCE
VAGRRLAPGKKITLSPDDPAHCQNCHCDGVNLTCEACQEPGGLVAPPTDAPVSSTTPYVE
DTPEPPLHNFYCSKLLDLVFLLDGSSMLSEAEFEVLKAFVVGMMERLHISQKRIRVAVVE
YHDGSRAYLELKARKRPSELRRITSQIKYTGSQVASTSEVLKYTLFQIFGKIDRPEASHI
TLLLTASQEPPRMARNLVRYVQGLKKKKVIVIPVGIGPHASLKQIRLIEKQAPENKAFLL
SGVDELEQRRDEIVSYLCDLAPEAPAPTQPPQVAHVTVSPGIAGISSPGPKRKSMVLDVV
FVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEE
VLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLP
GDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLVLQTCCSKEGLQLPTL
PPLPDCSQPLDVVLLLDGSSSLPESSFDKMKSFAKAFISKANIGPHLTQVSVIQYGSINT
IDVPWNVVQEKAHLQSLVDLMQQEGGPSQIGDALAFAVRYVTSQIHGARPGASKAVVIII
MDTSLDPVDTAADAARSNRVAVFPVGVGDRYDEAQLRILAGPGASSNVVKLQQVEDLSTM
ATLGNSFFHKLCSGFSGVCVDEDGNEKRPGDVWTLPDQCHTVTCLANGQTLLQSHRVNCD
HGPRPSCANSQSPVRVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVIFQNK
EQDLEVLLHNGACSPGAKQACMKSIEIKHAGVSAELHSNMEMAVDGRLVLAPYVGENMEV
SIYGAIMYEVRFTHLGHILTYTPQNNEFQLQLSPKTFASKMHGLCGICDENGANDFTLRD
GTVTTDWKRLVQEWTVQQPGYTCQAVPEEQCPVSDSSHCQVLLSASFAECHKVIAPATFH
TICQQDSCHQERVCEVIASYAHLCRTSGVCVDWRTTDFCAMSCPPSLVYNHCERGCPRHC
DGNTSFCGDHPSEGCFCPQHQVFLEGSCVPEEACTQCVGEDGVRHQFLETWVPDHQPCQI
CMCLSGRKINCTAQPCPTARAPTCGPCEVARLKQSTNLCCPEYECVCDLFNCNLPPVPPC
EGGLQPTLTNPGECRPTFTCACRKEECKRVSPPSCPPHRTPTLRKTQCCDEYECACSCVN
STLSCPLGYLASATTNDCGCTTTTCLPDKVCVHRGTVYPVGQFWEEGCDTCTCTDMEDTV
VGLRVVQCSQRPCEDSCQPGFSYVLHEGECCGRCLPSACKVVAGSLRGDSHSSWKSVGSR
WAVPENPCLVNECVRVEDAVFVQQRNISCPQLAVPTCPTGFQLNCETSECCPSCHCEPVE
ACLLNGTIIGPGKSVMVDLCTTCRCIVQTDAISRFKLECRKTTCEACPMGYREEKSQGEC
CGRCLPTACTIQLRGGRIMTLKQDETFQDGCDSHLCRVNERGEYIWEKRVTGCPPFDEHK
CLAEGGKIVKIPGTCCDTCEEPDCKDITAKVQYIKVGDCKSQEEVDIHYCQGKCASKAVY
SIDIEDVQEQCSCCLPSRTEPMRVPLHCTNGSVVYHEVINAMQCRCSPRNCSK
NT seq 8442 nt   +upstreamnt  +downstreamnt
atgaaccctttcaggtatgagatctgcctgcttgttctggccctcacctggccagggacc
ctctgcacagaaaagccccgtgacaggccgtcgacggcccgatgcagcctctttggggac
gacttcatcaacacgtttgatgagaccatgtacagctttgcagggggctgcagttatctc
ctggctggggactgccagaaacgttccttctccattctcgggaacttccaagatggcaag
agaatgagcctgtctgtgtatcttggggagttttttgacatccatttgtttgccaatggc
accgtaacgcagggtgaccaaagcatctccatgccctacgcctcccaaggactctaccta
gaacgcgaggctgggtactataagctctccagtgagacctttggctttgcggccagaatc
gatggcaatggcaacttccaagtcctgatgtcagacagacacttcaacaagacctgtggg
ctgtgcggtgattttaacatcttcgcggaagatgattttaggacgcaggaggggaccttg
acctcagacccctatgattttgccaactcctgggccctgagcagtgaggaacagcggtgt
aaacgggcatctcctcccagcaggaactgcgagagctcttctggggacatgcatcaggcc
atgtgggagcaatgccagctactgaagacggcatcggtgtttgcccgctgccaccctctg
gtggatcccgagtcctttgtggctctgtgtgagaagattttgtgtacgtgtgctacgggg
ccagagtgcgcatgtcctgtactccttgagtatgcccgaacctgcgcccaggaagggatg
gtgctgtacggctggactgaccacagtgcctgtcgtccagcttgcccagctggcatggaa
tataaggagtgtgtgtctccttgccccagaacctgccagagcctgtctatcaatgaagtg
tgtcagcagcaatgtgtagacggctgtagctgccctgagggagagctcttggatgaagac
cgatgtgtgcagagctccgactgtccttgcgtgcacgctgggaagcggtaccctcctggc
acctccctctctcaggactgcaacacttgtatctgcagaaacagcctatggatctgcagc
aatgaggaatgcccaggggagtgtcttgtcacaggccaatcgcacttcaagagcttcgac
aacaggtacttcaccttcagtgggatctgccaatatctgctggcccgggactgcgaggat
cacactttctccattgtcatagagaccatgcagtgtgccgatgaccctgatgctgtctgc
acccgctcggtcagtgtgcggctctctgccctgcacaacagcctggtgaaactgaagcac
gggggagcagtgggcatcgatggtcaggatgtccagctccccttcctgcaaggtgacctc
cgcatccagcacacagtgatggcttctgtacgcctcagctatgcggaggacctgcagatg
gactgggatggccgtgggcggctactggttaagctgtccccagtctattctgggaagacc
tgtggcttgtgtgggaattacaacggcaacaagggagacgacttcctcacgccggccggc
ttggtggagcccctggtggtagacttcggaaacgcctggaagcttcaaggggactgttcg
gacctgcgcaggcaacacagcgacccctgcagcctgaatccacgcttgaccaggtttgca
gaggaggcttgtgcgctcctgacgtcctccaagttcgaggcctgccaccacgcagtcagc
cctctgccctatctgcagaactgccgttatgatgtttgctcctgctccgacagccgggat
tgcctgtgtaacgcagtagctaactatgctgccgagtgtgcccgaaaaggcgtgcacatc
gggtggcgggagcctggcttctgtgctctgggctgtccacagggccaggtgtacctgcag
tgtgggaattcctgcaacctgacctgccgctccctctccctcccggatgaagaatgcagt
gaagtctgtcttgaaggctgctactgcccaccagggctctaccaggatgaaagaggggac
tgtgtgcccaaggcccagtgcccctgctactacgatggtgagctcttccagcctgcggac
attttctcagaccaccataccatgtgttactgtgaagatggcttcatgcactgtaccaca
agtggcaccctggggagcctgttgcctgacactgtcctcagcagtcccctgtctcaccgt
agcaaaaggagcctttcctgccggccacccatggtcaagctggtgtgtcctgctgacaac
ccacgggctcaagggctggagtgtgctaagacgtgccagaactacgacctggagtgtatg
agcctgggctgtgtgtctggctgcctctgtcccccaggcatggtccggcacgaaaacaag
tgtgtggccttggagcggtgtccctgcttccatcagggtgcagagtacgccccgggagac
acagtgaagattggctgcaacacctgtgtctgccgggagcggaagtggaactgcacgaac
catgtgtgtgacgccacttgctctgccattggtatggcccactacctcaccttcgatgga
ctcaagtacctgttcccgggggagtgccagtatgttctggtgcaggattactgtggcagt
aaccctgggacctttcagatcctggtgggaaatgagggttgcagctatccctcggtgaag
tgcaggaagcgggtgaccatcctggtggatggaggggagcttgaactgtttgacggagag
gtgaacgttaagaggcccctgagagatgaatctcactttgaggtggtggagtcgggccgg
tacgtcatcctgctgctgggtcaggccctttctgtggtctgggaccaccacctcagcatc
tctgtggtcctgaagcacacataccaggaacaggtgtgtggcctctgcgggaactttgat
ggcatccagaacaatgacttcaccactagcagcctccaggtggaggaagaccccgtcaac
tttgggaactcctggaaagtgagctcacagtgtgctgacacgagaaagctgtcactagat
gtttcccctgccacttgccacaacaacatcatgaaacagacgatggtggactcagcctgc
agaatccttaccagtgacgtcttccagggctgcaacaggctggtggaccctgagccatac
ctggacatctgtatttatgacacttgctcctgtgagtccatcggggactgcgcctgtttc
tgtgacaccattgctgcctatgcccacgtgtgtgcccagcatggccaggtggtagcctgg
aggacacccacactgtgcccccagagctgtgaagaaaagaatgttcgggaaaatggctat
gagtgtgagtggcgttataacagctgtgcgcctgcttgcccagtcacgtgtcagcaccct
gagcctctggcttgccctgtgcagtgtgtggagggttgtcatgcacattgccctccaggg
agaatcctggatgaacttctgcagacctgcgtagacccccaagactgccccgtgtgtgag
gtggctggtcggcgcttggctcctggaaagaaaatcaccttgagtcctgatgaccctgca
cactgtcagaattgtcactgtgatggtgtgaaccttacgtgtgaagcctgccaagagccc
ggaggcctggtggcacccccaactgatgccccagtcagctctaccaccccatatgttgag
gatacccccgagccccccctgcacaacttctactgcagcaagctgctggatcttgtcttc
ctgctggatggctcctctatgttgtccgaggctgagtttgaagtgctcaaagcttttgtg
gtgggcatgatggagaggttacacatctctcagaagcgcatccgcgtggcagtggtagag
taccatgatggctcccgtgcctaccttgagctcaaggcccggaagcgaccctcagagctt
cggcgcatcaccagccagattaagtatacaggcagccaggtggcctctaccagtgaggtt
ttgaagtacacactgttccagatctttggcaaaattgaccgccctgaagcctcccatatc
actctgctcctgactgctagccaggagcccccacggatggctaggaatttggtccgctat
gtccaaggtctgaagaagaagaaggttatcgtgatccctgtgggcattgggccccacgcc
agcctcaaacagatccgcctcatcgagaagcaggcccctgaaaacaaggcttttctgctc
agtggggtggatgagctggagcagagaagagatgagatagtcagctacctctgtgacctt
gctcccgaggccccagccccaactcagcctccacaggtagcccacgtcaccgtgagtcca
gggatcgctgggatctcgtcaccgggaccaaaacggaagtccatggttctggatgtggtg
tttgtcctggaggggtcagacgaagttggtgaagccaacttcaataagagcaaggagttc
gtggaggaggtaatccagcgcatggacgtgagcccggatgcaacgcgcatctcagtactg
cagtattcctacacggtaaccatggagtatgccttcaatggggcccagtccaaggaggag
gtgctgcggcacgtgcgagagatccgctaccagggcggcaataggacaaacactgggcag
gccctgcagtacctttctgagcacagcttctctcccagccaaggggaccgggtagaggca
cctaacctggtctacatggtcacggggaaccccgcctctgatgagatcaagaggttgcct
ggagacatccaggtggtacccattggggtgggcccccatgccaacatgcaggaactggag
aggatcagcaggcccatcgctcccatcttcatccgggactttgagacacttccccgagag
gctcctgacctggtcctgcagacatgttgctccaaggagggtctgcaactgcccaccctc
ccccctctccctgactgcagccaacccctggatgtggtcctgctcctggatggctcctct
agcttgccagagtcttcctttgataaaatgaagagttttgccaaggctttcatttcaaag
gccaacattgggccccacctcacacaggtgtccgtgatacagtatggaagcatcaatacc
attgatgtaccatggaatgtggttcaggagaaagcccatctacagagtttggtggacctc
atgcagcaggagggtggccccagccagattggggatgctctggcctttgccgtgcgctat
gtaacttcacaaatccacggagccaggcctggggcctccaaagcagtggtcatcatcatc
atggatacctccttggatcccgtggacacagcagcagatgctgccagatccaaccgagtg
gcagtgtttcccgttggggttggggatcggtatgatgaagcccagctgaggatcttggca
ggccctggggccagctccaatgtggtaaagctccagcaagttgaagacctctccaccatg
gccaccctgggcaactccttcttccacaaactgtgttctgggttttctggagtttgtgtg
gatgaagatgggaatgagaagaggcctggggatgtctggaccttgccggatcagtgccac
acagtgacttgcttggcaaatggccagaccttgctgcagagtcatcgtgtcaattgtgac
catggaccccggccttcatgtgccaacagccagtctcctgttcgggtggaggagacgtgt
ggctgccgctggacctgcccttgtgtgtgcacgggcagttccactcggcacatcgtcacc
ttcgatgggcagaatttcaagcttactggtagctgctcctatgtcatctttcaaaacaag
gagcaggacctggaagtgctcctccacaatggggcctgcagccccggggcaaaacaagcc
tgcatgaagtccattgagattaagcatgctggcgtctctgctgagctgcacagtaacatg
gagatggcagtggatgggagactggtccttgccccgtacgttggtgaaaacatggaagtc
agcatctacggcgctatcatgtatgaagtcaggtttacccatcttggccacatcctcaca
tacacgccacaaaacaacgagttccaactgcagcttagccccaagacctttgcttcgaag
atgcatggtctttgcggaatctgtgatgaaaacggggccaatgacttcacgttgcgagat
ggcacggtcaccacagactggaaaaggcttgtccaggaatggacggtgcagcagccaggg
tacacatgccaggctgttcccgaggagcagtgtcccgtctctgacagctcccactgccag
gtcctcctctcagcgtcgtttgctgaatgccacaaggtcatcgctccagccacattccat
accatctgccagcaagacagttgccaccaggagcgagtgtgtgaggtgattgcttcttac
gcccatctctgtcggaccagtggggtctgtgttgattggaggacaactgatttctgtgct
atgtcatgcccaccgtccctggtgtataaccactgtgagcgtggctgccctcggcactgc
gatgggaacactagcttctgtggggaccatccctcagaaggctgcttctgtccccaacac
caagtttttctggaaggcagctgtgtccccgaggaggcctgcactcagtgtgttggcgag
gatggagttcgacatcagttcctggagacctgggtcccagaccatcagccctgtcagatc
tgtatgtgcctcagtgggagaaagattaactgcactgcccagccgtgtcccacagcccga
gctcccacgtgtggcccatgtgaagtggctcgcctcaagcagagcacaaacctgtgctgc
ccagagtatgagtgtgtgtgtgacctgttcaactgcaacttgcctccagtgcctccgtgt
gaaggagggctccagccaaccctgaccaaccctggagaatgcagacccacctttacctgt
gcctgcaggaaagaagagtgcaaaagagtgtccccaccctcctgcccccctcaccggaca
cccactctccggaagacccagtgctgtgatgaatacgagtgtgcttgcagctgtgtcaac
tccacgctgagctgcccacttggctacctggcctcagccactaccaatgactgtggctgc
accacgaccacctgtctccctgacaaggtttgtgtccaccgaggcaccgtctaccctgtg
ggccagttctgggaggagggctgtgacacgtgcacctgtacggacatggaggatactgtc
gtgggcctgcgtgtggtccagtgctctcaaaggccctgtgaagacagctgtcagccaggt
ttttcttatgttctccacgaaggcgagtgctgtggaaggtgcctgccctctgcttgcaag
gtggtggctggctcactgcggggcgattcccactcttcctggaaaagtgttggatctcgg
tgggctgttcctgagaacccctgcctcgtcaacgagtgtgtccgcgtggaggatgcagtg
tttgtgcagcagaggaacatctcctgcccacagctggctgtccctacctgtcccacaggc
ttccaactgaactgtgagacctcagagtgctgtcctagctgccactgtgagcctgtggag
gcctgcctgctcaatggcaccatcattgggcccgggaagagtgtgatggttgacctatgc
acgacctgccgctgcatcgtgcagacagacgccatctccagattcaagctggagtgcagg
aagactacctgtgaggcctgccccatgggctatcgggaagagaagagccagggtgaatgc
tgtgggagatgcttgcctacagcttgcactattcagctaagaggaggacggatcatgacc
ctgaagcaagatgagacattccaggatggctgtgacagtcatttgtgcagggtcaacgag
agaggagagtacatctgggagaagagggtcacgggctgcccaccatttgatgaacacaag
tgtctggctgaaggaggcaaaatcgtgaaaattccaggcacctgctgtgacacatgtgag
gagcctgattgcaaagacatcacagccaaggtgcagtacatcaaagtgggagattgtaag
tcccaagaggaagtggacattcattactgccagggaaagtgtgccagcaaagctgtgtac
tccattgacatcgaggatgtgcaggagcaatgctcctgctgcctgccctcgaggacggag
cccatgcgcgtgcccttgcactgcaccaatggctctgtcgtgtaccacgaggtcatcaac
gccatgcagtgcaggtgttctccccggaactgcagcaagtga

DBGET integrated database retrieval system