KEGG   Mus musculus (mouse): 22373
Entry
22373             CDS       T01002                                 

Gene name
Wap
Definition
(RefSeq) whey acidic protein
  KO
K17106  whey acidic protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    22373 (Wap)
Motif
Pfam: WAP Dickkopf_N
Other DBs
NCBI-GeneID: 22373
NCBI-ProteinID: NP_035839
MGI: 98943
Ensembl: ENSMUSG00000000381
Vega: OTTMUSG00000005118
UniProt: Q7M748
Position
11 A1; 11 4.61 cM
AA seq 134 aa
MRCLISLVLGLLALEVALAQNLEEQVFNSVQSMFPKASPIEGTECIICQTNEECAQNAMC
CPGSCGRTRKTPVNIGVPKAGFCPWNLLQMISSTGPCPMKIECSSDRECSGNMKCCNVDC
VMTCTPPVPVITLQ
NT seq 405 nt   +upstreamnt  +downstreamnt
atgcgttgcctcatcagccttgttcttggcctgctggccctggaggtggccctcgctcag
aacctagaggaacaagtcttcaactcagttcagtccatgttcccaaaagccagccccatt
gagggcacagagtgtatcatctgccaaaccaacgaggagtgtgcccagaatgccatgtgc
tgtcccggttcctgtggtaggacccgcaaaactcctgtcaacattggtgttccgaaagct
ggcttctgcccttggaatctactccaaatgatcagtagtaccgggccgtgcccaatgaag
atagaatgctccagcgaccgtgagtgttctggcaacatgaaatgctgcaacgtcgactgt
gtcatgacatgtacacccccagtgccagtgataacccttcagtga

DBGET integrated database retrieval system