KEGG   Mus musculus (mouse): 223752
Entry
223752            CDS       T01002                                 

Gene name
Gramd4, 9930016O13
Definition
(RefSeq) GRAM domain containing 4
  KO
K23554  GRAM domain-containing protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    223752 (Gramd4)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    223752 (Gramd4)
SSDB
Motif
Pfam: GRAM PRT_C DUF639 Herpes_UL25 FA_desaturase
Other DBs
NCBI-GeneID: 223752
NCBI-ProteinID: NP_766199
MGI: 2676308
Ensembl: ENSMUSG00000035900
Vega: OTTMUSG00000025710
UniProt: Q8CB44
Position
15; 15 E2
AA seq 582 aa
MLRRLDRIRFRGHKREDLLDLAESPNASDTECGDEIPLKTPRPSPRDSEELRDPAGPGTL
IMAAGVQDFNRTEFDRLNEIKGHLEIALLEKHFLQEELRKLREETNSEMLRQELDRERQR
RIELEQKMQEVLKARSEEQPAQPQQPPKGQSQASNGTGTERRSQGLASRVQKWFYERFGE
YIEDFRFQPEENTVETEEPLSARRLTENMRRLKRGAKPVTNFVKNLSALSDWYSIYTSAI
AFTVYMNAVWHGWAIPMFLFLAILRLSLNYLIARGWRIQWSIVPEVSEAVEPAKEDLTVS
EKFQLVLDVAQKAQNLFGKMADILEKIKNLFMWVQPETTQKLYVALWAAFLASCFFPYRL
VGLAVGLYAGIKFFLIDFIFKRCPRLRAKYDTPYIIWRSLPTDPQLKERAGATVSRRLQT
ASSRSYVSSAPAGLSKDEDAGRFHSTKKGNFHEIFNLTENERPLAVCENGWRCCLINRDR
KMPTDYIRNGVLYVTENYLCFESSKSGSSKRNKVIKLMDITDIQKYKVLSVLPGSGMGIA
VSTPSTQKPLVFGAMVHRDEAFETIFSQYVKITSAAASGGDS
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgctcaggaggctggataggatcaggttcagaggacacaagagagaggacctccttgat
ctagccgagtccccaaatgcctcggacaccgagtgcggagacgagatccccctgaagacg
ccacggccctcgccccgggacagtgaggagctcagggaccctgctggtccagggaccctc
atcatggcggcaggcgtgcaggacttcaacaggacagagttcgatcgactgaacgagatc
aagggccatctggaaatcgccttactggaaaagcactttcttcaggaggagctccggaag
cttcgagaagagaccaactcagagatgctgcggcaggagctggatcgggagcggcagcgc
cggatcgaactggaacagaaaatgcaggaggtgctaaaggccaggtccgaggagcagcca
gcacagcctcagcagccaccaaagggacagagccaggccagcaatggcacaggcacagag
cgccgcagccagggcttggcctcccgtgtacagaagtggttctatgagaggtttggggaa
tacatcgaggacttccgcttccaaccagaggagaacacagtagagacggaggagcccctc
agcgcccgcaggttaactgaaaacatgagaagactgaagcgcggtgccaagcctgtcact
aacttcgtgaagaacctgtctgccttatctgactggtactccatctacacctccgccatc
gccttcacggtatacatgaatgctgtgtggcacggctgggccatccccatgttcctgttc
ctagcaattctgaggttgtccctcaattacctcatcgccaggggctggcggatacaatgg
agcattgtgccggaagtgtctgaagctgtggaacccgcaaaggaagatctgaccgtgtct
gagaagttccagctggtgctggatgtggcccagaaagcacagaatctcttcggcaagatg
gccgacatcctggaaaagatcaagaacttgttcatgtgggtgcaacctgagaccacgcag
aagctctatgttgccctgtgggccgcctttctggcttcttgcttcttcccctaccgcctg
gtggggcttgctgttggcctctatgccggcatcaagtttttcttaattgacttcatcttc
aaacgctgcccaagacttcgagccaagtatgacaccccctatatcatctggaggagcctg
cccactgaccctcagctcaaagagcgtgctggtgccaccgtgtcacgcaggctgcagaca
gcctcatcacggagctacgtctccagtgctccagctggtctgagtaaggacgaagatgct
ggacgctttcacagcaccaagaaggggaacttccacgaaatcttcaacttgactgaaaac
gagcgcccgctagcagtgtgcgagaatggctggcgctgctgcctcattaaccgagaccgg
aagatgcccacggactacatcaggaacggggttctgtatgtgacagagaattacctgtgc
ttcgagagctccaagtctgggtcatcaaagaggaacaaggtgatcaaactgatggacatc
acagacatccagaagtataaagtcttgtctgtcctccctggctcaggcatgggaattgct
gtttctacaccatcaacccagaaacccctggtgttcggtgccatggtgcacagagatgaa
gcctttgagaccattttcagccagtatgtgaaaatcacgtctgcagcggcctctggcggt
gacagctag

DBGET integrated database retrieval system