KEGG   Mus musculus (mouse): 223753
Entry
223753            CDS       T01002                                 

Gene name
Cerk, AI848610, D330016D08Rik, mKIAA1646
Definition
(RefSeq) ceramide kinase
  KO
K04715  ceramide kinase [EC:2.7.1.138]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    223753 (Cerk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.138  ceramide kinase
     223753 (Cerk)
SSDB
Motif
Pfam: CERK_C DAGK_cat
Other DBs
NCBI-GeneID: 223753
NCBI-ProteinID: NP_663450
MGI: 2386052
Ensembl: ENSMUSG00000035891
Vega: OTTMUSG00000023778
UniProt: Q8K4Q7
Position
15; 15 E2
AA seq 531 aa
MGAMGAAEPLHSVLWVKRRRCAVSLEPARALLRWWRSPEPGPSAPGADARSVLVSEIIAV
EEKDDCEKHASSGRWHKMENPFAFTVHRVKRVRHHRWKWARVTFWSADEQLCHLWLQTLR
GLLESLTSRPKHLLVFINPFGGKGQGKRIYEKTVAPLFTLASITTEIIITEHANQAKETL
YEINTDSYDGIVCVGGDGMFSEVLHGVIGRTQQSAGIDPNHPRAVLVPSTLRIGIIPAGS
TDCVCYSTVGTNDAETSALHIIIGDSLAIDVSSVHYHNTLLRYSVSLLGYGFYGDLIKDS
EKKRWMGLVRYDFSGLKTFLSHQYYEGTLSFLPAQHTVGSPRDNKPCRAGCFVCRQSKQQ
LEEEEKKALYGLENAEEMEEWQVTCGKFLAINATNMSCACPRSPGGLSPFAHLGDGSSDL
ILIRKCSRFNFLRFLIRHTNQEDQFDFTFVEVYRVKKFHFTSKHVEDEDNDSKEQEKQKF
GKICKDRPSCTCSASRSSWNCDGEVMHSPAIEVRVHCQLVRLFARGIEEES
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgggggcaatgggggcggcggagccgctgcactccgtgctgtgggtgaaacggcgacgc
tgtgccgtcagcctggagcccgcgcgggctctgctacgctggtggcggagcccggagccc
gggccctccgcgccgggtgccgatgcccgctcggtactggtgtcggagatcatcgctgtt
gaggaaaaagacgactgcgagaaacacgcctccagtggccgatggcataaaatggaaaat
ccgttcgcattcacagtccaccgtgtgaagcgagtacgacatcaccgctggaagtgggca
cgggtgaccttctggagcgccgacgagcagctgtgtcacctgtggctgcagaccctccgt
gggctgctggagagcctgacttcaagaccgaagcacttgctggtattcatcaaccctttc
ggagggaaaggtcagggcaagcgcatctatgaaaaaacagtggcgcctctgtttaccttg
gcttccatcactacggagatcatcattacagagcatgccaaccaagccaaggagacttta
tacgagatcaacacagacagctatgatggcatcgtgtgcgtaggtggggacggcatgttc
agcgaggtgctgcatggggtgattgggaggacgcagcagagcgctggtatcgaccccaat
cacccccgagccgtgctggtgcccagtaccctcaggatcggcatcatacccgcagggtcc
acagattgtgtgtgttactcaacagtgggcacaaacgacgcagagacatcggctttgcac
atcattattggggactcactggcaatagacgtgtcctctgtgcactaccataacacgctg
ctgcggtactcggtttctctgctgggctacggtttctacggggacttaatcaaggacagt
gaaaagaaacggtggatgggcctcgtccggtatgatttctcagggttgaagacctttctc
tctcatcagtactatgaagggacactgtccttcctcccagcacagcacacggtgggatct
ccacgggacaataaaccctgccgggctgggtgcttcgtgtgcaggcagagcaagcaacag
ctggaagaagaagagaagaaagccctgtatggcctggagaacgccgaggaaatggaagag
tggcaagtgacatgtgggaagttcctggccatcaatgccaccaacatgtcctgtgcttgt
cctcggagccctgggggcctgtccccatttgcccatctgggagatgggtcttctgacctc
atccttatccggaagtgctccaggttcaacttcctgagattcctcatccggcacacgaac
caggaggaccagttcgacttcactttcgttgaagtttatcgagtcaagaaattccacttc
acgtcgaagcacgtggaagacgaggacaatgactcgaaggaacaagagaagcagaagttt
gggaagatctgcaaggacagaccctcttgcacttgctcagcctccagaagctcctggaac
tgcgatggcgaagtcatgcacagcccggccattgaggtcagggtccactgccagctggtg
cgcctctttgctcggggaatcgaggaagagtcataa

DBGET integrated database retrieval system