KEGG   Mus musculus (mouse): 22376
Entry
22376             CDS       T01002                                 

Gene name
Was, U42471, W, Wasp
Definition
(RefSeq) Wiskott-Aldrich syndrome
  KO
K05747  Wiskott-Aldrich syndrome protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04666  Fc gamma R-mediated phagocytosis
mmu05135  Yersinia infection
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    22376 (Was)
   04530 Tight junction
    22376 (Was)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    22376 (Was)
   04062 Chemokine signaling pathway
    22376 (Was)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    22376 (Was)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    22376 (Was)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    22376 (Was)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22376 (Was)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    22376 (Was)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    22376 (Was)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     22376 (Was)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EVH1 / WASP  homology  (WH) domain-containing proteins
  WH1 domain-containing proteins
   22376 (Was)
SSDB
Motif
Pfam: WH1 PBD WH2
Other DBs
NCBI-GeneID: 22376
NCBI-ProteinID: NP_033541
MGI: 105059
Ensembl: ENSMUSG00000031165
Vega: OTTMUSG00000018093
UniProt: P70315 Q53WY0
Position
X A1.1; X 3.65 cM
AA seq 520 aa
MNSGPGPVGGRPGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATTVVQLYLALP
PGAEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFA
GDDCQVGLNFADESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPINEERRGGLPPVP
PHPGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADI
GAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQG
GLEAVRQEMRRQEPLPPPPPPCRGGGGGGGGGGGGGGGGGGQPLRPPVVGSNKGRSGPLP
PVPMGGAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPP
PPCPGSGPAPPPLPPTPVSGGSPAPGGGRGALLDQIRQGIQLNKTPGALENSVQQPPAQQ
SEGLVGALMHVMQKRSRVIHSSDEGEDQTGEDEEDDEWDD
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgaatagtggccctggccctgtaggaggcaggcctgggggccgagggggaccagccgtt
cagcagaacattccttccaacctcctccaggaccatgaaaaccagagactctttgagctt
cttggccgaaaatgctggacactggctaccacagttgttcagctctacctggcactgccc
cctggagctgagcactggaccatggaacactgcggggctgtgtgcttcgtgaaggataac
cctcagaagtcctacttcatccgcctttatggcctacaggctggtcggctactctgggaa
caggagctgtactctcagctggtttatctcactcccaccccgttcttccacacttttgct
ggagatgactgtcaagtaggactgaactttgcggatgagagtgaagcccaggccttccgg
gccttggtgcaggagaagatacaaaaaaggaatcagaggcaaagcggagaaagacgccag
ctaccaccaccaccagcaccaatcaatgaggagagaagaggagggctcccacctgtgccc
ccacacccgggtggagatcatgggggcccatcaggtggtccactatctctaggacttgtg
acggtcgacattcagaaccctgacatcacaagttcacgataccgtgggctccctgcacct
ggccctggcccaactgataagaaacgctcagggaaaaagaagatcagcaaagctgatatc
ggagcaccgagtggattcaaacatgtcagccacgtgggctgggatccccagaatggattt
gatgtgaacaacctagacccggatctgcggagcttgttctccagggcaggaatcagcgag
gcccagctcactgacgcagagacctccaagctcatctacgattttattgaggaccaggga
ggtctagaggctgtccggcaggagatgaggcgccaagagccactcccaccacctccgccg
ccatgcagaggaggaggaggaggaggaggaggaggaggaggaggaggaggaggaggagga
ggccagcctctgagacctcctgttgtggggagtaataagggtcgctcaggtccactgccc
cctgtacctatggggggtgccccacctccaccaacaccacgagggcccccaccaccaggc
cgagggggtcctcctccaccaccccctccagccactggacgatctggaccaccacctcct
ccactccctggagctgggggaccaccagcaccgccaccaccaccaccaccaccaccacct
ccaccctgccctgggagtgggcccgcccctcccccgctccctcctactccagtgtctggg
gggagcccagcacctggtgggggccggggtgcacttttggaccaaatccggcagggaatt
cagctgaacaagacccctggagctctagagaactcagtacagcaaccacccgcgcagcag
tcagaaggcctagtaggtgccctgatgcatgtcatgcagaagaggagtagagtcatccat
tcctcagatgaaggggaggatcagaccggcgaggatgaagaggatgatgaatgggatgac
taa

DBGET integrated database retrieval system