KEGG   Mus musculus (mouse): 223773
Entry
223773            CDS       T01002                                 

Gene name
Zbed4, 1700009F06Rik
Definition
(RefSeq) zinc finger, BED type containing 4
  KO
K24640  zinc finger BED domain-containing protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    223773 (Zbed4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BED
    223773 (Zbed4)
SSDB
Motif
Pfam: zf-BED Dimer_Tnp_hAT
Other DBs
NCBI-GeneID: 223773
NCBI-ProteinID: NP_852077
MGI: 2682302
Ensembl: ENSMUSG00000034333
Vega: OTTMUSG00000017462
UniProt: Q80WQ9
Position
15; 15 E3
AA seq 1168 aa
MEDKQETCPKGDSDFVSDKVNFKTEEDDDQTPCHSLEQVDFKSESEDMRQTDSGDEQADI
RAASCACQPSGKFLAAESEDDYGSLFSQYSSTLYSVAMEAVTQSLLSSRHISSRKKSPAW
KHFFISPRDSTKAICTYCMKEFSRGKNEKDLSTSCLMRHVRRAHPTKLIQENGSLSAGSS
FSPPSLLLPPQPADVGDLSTVLSPVRLVQKMAPKIPSPDQIMEESVTVVSSEELSSDVSV
TEKYSREEALAGSSPNLSMLHYDDASETMADRNLSLPKSTSGSRRRSAVWKHFYLSPLDS
SKAVCVHCMNEFSRGKNGKDLGTSCLIRHMWRAHRSIVLQENGGNTGIPPLYPMPPTLLP
ALLPPEGDLNSASLSPGKQVKESPSASSSPERLPEDLSSHTNPGDVSREDVSMLSSSDDL
GEASVVSSPEKQPADTVNPRFESGTVFQQNKKVMRRLKSEVWHHFSLAPMDSLKAVCRYC
SCVISRGKKGDVGTSCLMRHLYRRHPEVVGNQKDFLGASLANSPYATLASAESSSKLTDL
PAVVRKNHQGVFPTNSKKTSKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCLL
RHLQRFHGHVLKNDVSEATLSRSPGIRRPLGIELSGPSSFRDSTEKFYDSHPVAKKITSL
IAEMIALDLQPYSLVDNVGFNRLLEYLKPQYSLPSPSYFSRTAIPGMYDNVKQIIMSHLK
EAESGVVHFTSGIWMSSQTREYLTLTAHWVTFASAVRPHCEDHHCSALLDVSQIDCDYSG
NSIQKQLECWWEAWVTSIGLQIGITVTDNPSIGKMLSEGEHSSVQCFSHTVNLIVSEAIK
SQRMVQNLLSIARKLCERVHRSPRAREKLAELQKEYELPQHQLIQDVPSKWSTSFHMLER
LIEQKRAVNEVSIECNFRELISCDQWEVMQSVCHVLRPFDAASREMSAHMSTLSQVIPMI
HILSRKVEMLFGETMGIDTMLKSLKEAMASRLSATLHDPRYIFATLLDPRYKASLFTEEE
AEQYRQDLIRELEILNSTSEDTATSNGCDSGSPLKDTGTEESLWSLAPIKRDQREKLPED
MVLAYLEEEVLEHSCDPLTYWNLKRSSWPGLSTLAVRFLGCPPSTVPSEKLFSTPMDAGS
FGQPRLMMEHFEKLIFLKVNLPLICFQY
NT seq 3507 nt   +upstreamnt  +downstreamnt
atggaggataagcaagaaacttgtcccaagggggacagtgattttgtttctgacaaagta
aatttcaaaacggaggaagatgatgatcaaactccttgtcacagtttggaacaagtggac
tttaaaagtgagtcagaggatatgagacagacagacagtggcgatgaacaggcagacatc
agggcagcgagctgtgcctgtcagccctctgggaagttcttagctgccgagagtgaggat
gactatggctcactcttctcccagtatagtagcacactgtacagcgtagccatggaagct
gtgacccagagccttctttccagtcgacacataagctccaggaagaagtctccagcctgg
aagcatttctttatttcccctcgagatagcactaaggctatctgcacatactgtatgaaa
gagttcagtaggggcaagaatgagaaagacctgagtacaagttgcctcatgagacatgtg
aggcgggcacaccccaccaagctcattcaagaaaatggaagtctatcggcagggtcctcc
ttttcccctccctctctgttgcttccaccacagcctgcagatgtgggagaccttagcact
gtgctctcgcctgtcagacttgtccagaaaatggctcccaagatcccatcccctgaccaa
ataatggaagagtctgtgactgtagtttcttctgaagagttgtcctctgatgtgtctgtc
actgaaaagtacagcagagaggaggccttggcaggctcctcccccaacctctccatgctc
cattatgacgacgcttcagaaaccatggcagacagaaacctttctcttcccaaaagcaca
tctgggtccaggaggaggtcagccgtctggaagcacttctacttgtcaccccttgatagc
tccaaggctgtctgtgtccactgtatgaatgagttcagtagagggaaaaatgggaaggac
ctgggtacaagctgcctcatcaggcacatgtggagagcacatcgctccattgtactgcag
gagaacgggggcaacacaggcatcccaccattgtaccctatgccccccaccctgctgcct
gccctgctgcccccagaaggggatctcaactccgcatcgttgtctccaggcaaacaagtc
aaagagtccccttctgcctcctcatccccagaaaggcttccggaggacctgtcatcacac
actaatcctggggatgtatcccgggaagatgtgtccatgttgtcatcctctgatgacttg
ggggaggcctctgtagtgtcttctccagagaagcagccagcggacacggtaaatccaagg
tttgaatcaggtactgttttccagcaaaataagaaggtgatgagaagactaaagtcagaa
gtctggcatcacttttccctggcccccatggacagtctcaaagcagtgtgccggtactgt
agctgcgttattagtcgggggaagaagggagatgttggcaccagttgtttgatgcgacac
ctgtacagacgccaccctgaggtggttgggaaccagaaggactttctgggtgcaagtttg
gcaaactctccatatgccactttggcttctgcagaaagctcctccaagttaactgacttg
ccagcagtggtcagaaaaaaccatcaaggtgtgtttcctactaatagcaagaagacctca
aagctgtggaatcacttttctatttgttcagcagactcaacaaaggtggtgtgcctgcac
tgtggccggaccatcagcaggggcaagaaacccaccaacctgggcaccagctgtctcctg
agacatctgcagcggttccatggccatgtactcaagaatgatgtctcagaggccactctg
tcccgttctccaggcatccggaggcctctgggcatagagctctcagggccttcctctttc
cgtgactccacagagaagttctatgactctcatccagttgccaaaaaaatcacaagtctc
atagctgaaatgattgcacttgaccttcagccatattcccttgtagacaacgttggcttt
aacaggctgctcgaatacttgaaacctcagtactctttaccctccccttcctacttctct
agaacagctatcccaggtatgtatgacaatgtgaaacagataattatgtcacatctgaag
gaagctgagagtggtgtggttcacttcacctctggaatatggatgagtagccagactcgt
gaatacctgacccttacagctcactgggtcaccttcgcatccgctgtccgaccacattgt
gaggaccaccattgctcagcacttttagatgtctcacaaatcgactgtgactatagtgga
aatagcattcagaagcagctggagtgttggtgggaagcctgggtgacttccattggcctt
cagattggcatcactgtcactgacaatccaagcatagggaagatgctgagtgagggtgaa
cactcaagtgtgcagtgcttcagtcacacagtgaatctgattgtgagcgaggctatcaag
agccagaggatggtgcagaacttactgagtattgcccggaagctgtgtgagcgggtccat
cggtcacccagagcaagagagaagttagcagaactgcagaaagagtacgagctgccacag
caccagctgatccaggatgtaccgtctaagtggagcacatcgttccacatgctcgaacgt
ctgattgagcagaagagggcagttaatgaggtatccattgagtgtaacttcagagaattg
atcagctgtgaccagtgggaggtcatgcagtctgtgtgccatgtgctgagaccatttgat
gctgcaagccgagagatgagtgcccacatgtctacgctgagccaggtcatccccatgatc
cacatcctcagcagaaaagtggagatgctgtttggggagaccatgggcattgacaccatg
cttaagtccctgaaggaagccatggcaagccgcctgtctgccacactccatgaccccagg
tacatctttgccacactgctggaccctcgctacaaagcttccctgttcacagaggaggag
gcagagcagtacaggcaagacttaatcagggagctagaaatactgaattctacctcagag
gacactgccacctccaatggctgtgactcagggtccccacttaaagacactggcacagag
gagagcctgtggtcactcgcaccgataaagagagatcagagagagaagctacctgaagac
atggtgcttgcgtatttggaggaagaggtgctggaacacagctgtgacccactcacctac
tggaacctaaagcggtcatcgtggcctgggctgtctaccttagcagttcgatttctggga
tgtcccccaagtacagtcccctcagaaaagctgttcagcacacccatggatgctggcagc
tttggccagcccaggctcatgatggagcattttgaaaagctcatctttttaaaagtgaat
cttcctttaatatgctttcagtattga

DBGET integrated database retrieval system