KEGG   Mus musculus (mouse): 223780
Entry
223780            CDS       T01002                                 

Gene name
Adm2, Am2, IM, IMD, Imdn, inter
Definition
(RefSeq) adrenomedullin 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Calc_CGRP_IAPP
Other DBs
NCBI-GeneID: 223780
NCBI-ProteinID: NP_891558
MGI: 2675256
Ensembl: ENSMUSG00000054136
UniProt: Q7TNK8
Position
15; 15 E3
AA seq 150 aa
MAQLLMVTVTLGCISLLYLLPGTLSGSLGKGLRHSRPREPPAKIPSSNLQPGHPSLQPVV
WKSRRHAPQPQGRGNRALAMVHLPQGGGSRHPGPQRPTGSRRPHAQLLRVGCVLGTCQVQ
NLSHRLWQLVRPAGRRDSAPVDPSSPHSYG
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcccagttgctgatggtcacggtaaccctcggttgcatcagcctcctctacctgctc
cccggcacgttgtctggcagcctgggcaagggactgaggcactccagacccagagagccc
ccagctaagattccttccagtaacctgcagcctggacacccttcccttcagcctgtagtc
tggaagtctcgtcgtcatgccccccagccacagggaaggggcaacagggcccttgctatg
gttcatctgcctcagggtggtggctcacgacaccctggtccccagcgtcccacgggatcc
cgaagaccccatgcccagctcctgcgggttggctgtgtactgggtacatgccaagtccag
aatcttagccatcgcctgtggcagcttgtccggccagctggccggcgggactcagctcct
gtggatcccagcagcccccacagttatggctga

DBGET integrated database retrieval system