KEGG   Mus musculus (mouse): 223864
Entry
223864            CDS       T01002                                 

Gene name
Rapgef3, 2310016P22Rik, 9330170P05Rik, Epa, Epac, Epac1
Definition
(RefSeq) Rap guanine nucleotide exchange factor (GEF) 3
  KO
K08014  Rap guanine nucleotide exchange factor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04670  Leukocyte transendothelial migration
mmu04720  Long-term potentiation
mmu04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    223864 (Rapgef3)
   04072 Phospholipase D signaling pathway
    223864 (Rapgef3)
   04024 cAMP signaling pathway
    223864 (Rapgef3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    223864 (Rapgef3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    223864 (Rapgef3)
  09156 Nervous system
   04726 Serotonergic synapse
    223864 (Rapgef3)
   04720 Long-term potentiation
    223864 (Rapgef3)
SSDB
Motif
Pfam: RasGEF cNMP_binding DEP RasGEF_N
Other DBs
NCBI-GeneID: 223864
NCBI-ProteinID: NP_659099
MGI: 2441741
Ensembl: ENSMUSG00000022469
Vega: OTTMUSG00000032758
UniProt: Q8VCC8
Position
15; 15 F1
AA seq 918 aa
MKVSWPGENHWQVGPAVVESPAVGAPQVGGLPDVVPEGTLLNMVLKRMHRPRCCSYQLVF
EHRRPSCIQGLRWTPLTNSEDSLDFRVSLEQATTEHVHKAGKLLHRHLLATYPTLIRDRK
YHLRLYRHCCSGRELVDGILALGLGVHSRSQAVGICQVLLDEGALCHVKHDWTFQDRDAQ
FYRFPGPEPEPTGTQDVEEELVEAMALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILRENNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERTSQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMRPDSSAHDPTETFLSD
FLLTHSVFMPSTQLFTALLHHFHVEPADPAGGSEQEHSTYICNKRQQILRLVGRWVALYS
PMLHSDPVATSFLQKLSDLVSRDARLSNLLREQYPERRRHHRLENGCGNVSPQTKARNAP
VWLPNQEEPLPSSAGAIRVGDKVPYDICRPDHSVLTLHLPVTASVREVMAALAHEDHWTK
GQVLVKVNSAGDVVGLQPDARGVATSLGLNERLFVVDPQEVHELTPHPEQLGPTLGSSEM
LDLVSAKDLAGQLTDHDWNLFNRIHQVQEHLRDVTTANLERFMRRFNELQYWVATELCLC
PVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYS
ALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLLKDVTFIHEGNHTLVENLINFEKMRMM
ARAVRMLHHCRSHSTAPLSPLRSRVSHIHEDSQGSRISTCSEQSLSTRSPASTWAYVQQL
KVIDNQRELSRLSRELEP
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgaaggtcagctggccaggtgagaaccactggcaggtgggcccagctgtggtggagagt
ccagctgtgggggcaccgcaggtgggaggtctcccggacgtggttccggagggcacgctg
ctcaatatggtgttgaagagaatgcaccgtccccgctgctgctcttaccagctagtgttc
gagcaccggcgccccagctgcatccagggactccgctggacaccacttaccaacagcgag
gactccctggatttcagagtgagtctggagcaggccaccacagagcatgtgcacaaggca
gggaagctcctgcaccgccatctcttggccacgtaccctaccctcatccgagacagaaaa
taccatctgcgactatatcggcattgctgctctggccgggagctagtggatgggatcttg
gctctggggcttggggtccactcacggagccaagccgtgggcatctgccaagtgttgctg
gatgagggtgccctttgtcatgtaaaacatgactggaccttccaggaccgagatgcccaa
ttctacaggttccctggaccggagcccgagcctacaggaactcaagatgtggaagaggag
cttgttgaggctatggccctcctgtcccagcgagggcctgatgccctactcaccgtggcg
ctccggaagcccccaggtcagcgtacggatgaagaactggacctgatctttgaagagctg
ctgcatatcaaggcggtggcacacctttctaactcggtgaagcgggaactagctgctgtt
ctgctctttgaaccacacagcaaggcaggaactgtgttgttcagccagggggacaagggt
acctcgtggtacattatctggaagggatctgtcaatgtggtgacccatggcaaggggctg
gtgaccacgttgcacgagggagatgactttggacagctggctctggtgaacgacgcacct
cgggcagccaccatcatccttcgagaaaataactgtcactttctgcgtgtggacaagcag
gacttcaaccgcatcatcaaggatgtggaagcaaaaaccatgagactggaagaacacggc
aaagtggtcttagttctggagagaacctctcagggtgctggcccttcccgtcccccgacc
ccaggcaggaaccggtatacggtcatgtctggcaccccagagaaaatcctagaactgctg
ttggaggctatgagaccggattccagtgctcatgacccaacagagacgttcctcagtgac
ttcctgctgacccacagtgtcttcatgcccagcacccagctcttcactgccctcctgcac
cacttccacgtggagccagcagaccctgctggaggcagcgagcaggagcacagcacctac
atctgcaacaagaggcagcagatcctgcggctagttggccgatgggtggccctgtatagc
ccgatgctccactcggatcccgtggccaccagcttcctccagaaactctcagacctggtg
agcagagatgcccgacttagcaacttgctgagggaacagtatccagagagacggcgacac
cacaggttggaaaatggctgtgggaacgtatctcctcagaccaaggcccggaatgcacct
gtttggctccctaaccaggaggaacccctcccaagcagcgcgggtgccatccgagttggg
gacaaagtcccctacgacatctgcagacctgaccactcagtgctgaccctgcacctgccg
gtgacggcctcggtgagagaagtgatggcagctttggcccatgaggaccactggaccaag
ggacaggtgttggtgaaggtcaattctgccggtgatgtcgttggcttgcagccagatgcc
cgtggtgtggccacatccctggggctcaacgagcggctctttgttgtcgacccacaggaa
gtgcatgagctgaccccacaccctgagcagctgggccccactctgggttcttctgagatg
ctggacctagtgagcgccaaggacctggcaggccagctgaccgaccatgactggaacctc
ttcaacaggatccaccaggtgcaggagcacctgcgggatgtcaccaccgcgaacctggag
cgcttcatgcgccgcttcaacgagctgcagtactgggtggccacagagctctgtctctgc
cctgttcctggctcccgggctcagctactcaggaagttcatcaagctggcagcccacctc
aaggagcagaagaacctcaactctttctttgcggtcatgtttggcctcagcaactcggcc
atcagccggctggcccacacctgggagcgcctgccccataaagtacggaagctgtactca
gccctggaaaggttgctggacccttcctggaaccaccgagtgtaccgattggctctcacc
aagctctcccctcctgtcatccccttcatgcccctgctgctcaaagacgtgaccttcatc
catgaggggaaccacacactggtagagaacctcatcaactttgagaagatgcggatgatg
gccagagcggtgcggatgcttcaccactgccgaagtcacagtaccgcgcctctatcacca
ctcagaagccgagtgtcccacatccacgaggacagccagggatcaaggatctccacgtgt
tctgagcagtccctgagcacccggagtccagccagcacctgggcttatgtccagcagctg
aaggtcattgacaaccagcgggaactgtcccgcctctcccgggagctggaaccatga

KEGG   Mus musculus (mouse): 56508
Entry
56508             CDS       T01002                                 

Gene name
Rapgef4, 1300003D15Rik, 5730402K07Rik, 6330581N18Rik, EPAC_2, Epa, Epac-2, Epac2, cAMP-G, mKIAA4040
Definition
(RefSeq) Rap guanine nucleotide exchange factor (GEF) 4
  KO
K04351  Rap guanine nucleotide exchange factor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04670  Leukocyte transendothelial migration
mmu04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    56508 (Rapgef4)
   04072 Phospholipase D signaling pathway
    56508 (Rapgef4)
   04024 cAMP signaling pathway
    56508 (Rapgef4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    56508 (Rapgef4)
  09152 Endocrine system
   04911 Insulin secretion
    56508 (Rapgef4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    56508 (Rapgef4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56508 (Rapgef4)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    56508 (Rapgef4)
SSDB
Motif
Pfam: RasGEF cNMP_binding DEP RasGEF_N
Other DBs
NCBI-GeneID: 56508
NCBI-ProteinID: NP_001191094
MGI: 1917723
Ensembl: ENSMUSG00000049044
Vega: OTTMUSG00000013137
UniProt: Q9EQZ6 A2ASW4 Q571A8
Structure
PDB: 

Position
2; 2 C3
AA seq 1011 aa
MVAAHAAHSQSSAEWIACLDKRPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGY
YENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDN
TPRHATIVTRESSELLRIEQEDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENT
PLIEPHVPLRPAHTITKVPSEKILRAGKILRIAILSRAPHMIRDRKYHLKTYRQCCVGTE
LVDWMIQQTSCVHSRTQAVGMWQVLLEDGVLNHVDQERHFQDKYLFYRFLDDEREDAPLP
TEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYDELLHIKALSHL
STTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD
FGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKV
PAGNRAANQGNSQPQQKYTVMSGTPEKILEHFLETIRLEPSLNEATDSVLNDFVMMHCVF
MPNTQLCPALVAHYHAQPSQGTEQERMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVAMA
FLEEFYVSVSDDARMMAAFKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQK
RQPIRGSDEVLFKVYCIDHTYTTIRVPVAASVKEVISAVADKLGSGEGLIIVKMNSGGEK
VVLKSNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTTGTVGTFELMSSKDLAYQM
TTYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEVCLCSQLSKR
VQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLM
DPSRNHRAYRLTAAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTART
VRYYRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
NT seq 3036 nt   +upstreamnt  +downstreamnt
atggtcgctgcgcacgctgcacactctcagtcctcggccgagtggatcgcctgcctggat
aaaaggccgttggagcgatctagtgaagatgtggacataattttcacgcggctgaaagga
gttaaagcttttgagaaatttcacccaaacctccttcgtcagatttgtttatgcggttac
tatgagaacctggaaaaaggaatcacactgtttcgccaaggggatattggaaccaactgg
tatgctgtcctggctgggtctttggatgttaaagtgtctgagaccagcagtcaccaggat
gcggtgaccatctgcactctgggaattgggacagcctttggagagtccattctggataac
acccctcgccatgcaaccatcgttaccagggagagcagcgaacttctccgcattgagcag
gaggacttcaaggcactatgggagaaataccgacagtatatggccggacttctggctcct
ccctatggtgttatggaaacgggctctaacaatgacaggattcctgacaaggagaataca
cctctcattgaaccccacgttcctctccgtcctgctcacaccattaccaaggtcccttca
gagaagatcctcagagctggaaaaattttacgaattgccattctctctcgagctccccac
atgataagagacagaaagtaccacctaaagacatacagacaatgctgtgttgggactgag
ctggtagactggatgatacagcagacatcctgtgttcactcgcggactcaagctgttggc
atgtggcaagtcttgctggaagatggtgtcctcaaccatgtggaccaggagcgccatttc
caagacaaatatttattttatcgatttctggatgacgagcgtgaggatgcccctttgcct
actgaggaagagaagaaggagtgtgatgaagaacttcaggacaccatgctgctgctctca
cagatgggccctgacgcccacatgagaatgatcctgcgaaaaccacctggccagaggact
gtggatgacctagagattatctacgacgagctccttcatattaaagccttatcccatctc
tctaccacagtgaaacgggagttagcaggtgttctcatttttgagtctcacgccaaagga
ggaactgtgttgtttaaccagggggaagaaggtacctcctggtacatcattctgaaagga
tccgtgaatgtagtcatttatggcaagggtgtggtctgcaccctgcacgaaggagatgac
tttggcaagttagctctagtgaacgatgctccaagagctgcctccattgttcttcgggaa
gataattgtcacttcctaagagtcgacaaggaagacttcaatcggattctgagggacgtt
gaggcgaatacagtcagacttaaagaacatgaccaagatgtcttggtactggagaaggtc
ccagcagggaacagagctgctaatcaaggaaactcacagcctcagcaaaagtatactgtg
atgtcaggaacacctgaaaagattttagagcattttctagaaacaatacgccttgagcca
tcgttgaatgaagcaacagattcggttttaaatgactttgttatgatgcactgtgttttt
atgccaaatacccagctttgccctgcccttgtggcccattaccacgcacagccttctcaa
ggtaccgagcaggagagaatggattatgccctcaacaacaagaggcgggtcatccgcttg
gtcctgcagtgggcggccatgtatggcgatctcctccaagaagatgatgtggccatggcc
ttcctggaggagttctatgtgtctgtatcagatgacgcacggatgatggctgccttcaag
gagcagctgccagagctggagaagattgtcaagcaaatctcagaagacgcaaaagctcca
cagaagaagcacaaggtgcttttgcaacagttcaacacaggtgacgagagggcccagaag
cgtcagcctattcgtggctctgatgaggttttgttcaaggtctactgcatcgaccacacc
tatactaccattcgtgtgccggtagctgcctcggtgaaggaagtcatcagtgcagtagct
gacaaactgggctcaggggaaggcctgatcatcgtcaagatgaactctggaggagaaaag
gtggtgctgaaatctaatgatgtttcagtatttacgacgctcaccattaatggacgcctg
tttgcctgcccgagagagcaattcgactcactgactcccttgccggaacaggaaggcccg
accactgggacagtgggaacatttgagctgatgagctcgaaagacctggcgtaccagatg
acaacctacgattgggaactcttcaactgtgtgcatgagctggagctaatctaccacaca
tttggaaggcataattttaaaaagaccacggcaaacttggatttgttcctgaggaggttt
aatgaaattcagttttgggttgtcactgaggtctgcctttgttcccagctcagcaaacgt
gttcagcttttgaaaaaatttatcaagatagcggctcactgcaaggagtacaaaaatcta
aattcctttttcgccatcgtcatgggactcagcaacgtggccgtgagccgcttggcacta
acgtgggagaaactgccgagcaagtttaagaagttctatgcggagtttgagagcttgatg
gatccttccagaaaccacagggcatacaggctgacagcagccaagctggagccccctctc
atccctttcatgcccttgcttattaaagatatgacatttactcatgaggggaacaagacg
ttcattgacaatctagtaaactttgaaaaaatgcgcatgattgcaaacactgccagaaca
gtacggtactacaggagccagcccttcaatccggatgccgctcaagctaataagaaccat
caggatgtccggagttatgtacggcaattaaatgtgattgacaaccagagaactttatca
cagatgtcacacagattagagcctcgaaggccatag

DBGET integrated database retrieval system