KEGG   Mus musculus (house mouse): 223870
Entry
223870            CDS       T01002                                 
Symbol
Senp1, 2310046A20Rik, D15Ertd528e, E330036L07Rik, suPr-2
Name
(RefSeq) SUMO1/sentrin specific peptidase 1
  KO
K08592  sentrin-specific protease 1 [EC:3.4.22.68]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    223870 (Senp1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    223870 (Senp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     223870 (Senp1)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C48: Ulp1 endopeptidase family
   223870 (Senp1)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   223870 (Senp1)
SSDB
Motif
Pfam: Peptidase_C48
Other DBs
NCBI-GeneID: 223870
NCBI-ProteinID: NP_659100
MGI: 2445054
Ensembl: ENSMUSG00000033075
UniProt: P59110
Position
15:complement(97936625..97991625)
AA seq 640 aa
MDDTADGVKMDAGEVTLVNHGSTFRTHRPPQSGFPEEQLLLSDQQSLPFRQGTLDGSFTC
STRSPAYRPDYHSDNPSSDSFLGSGDVRTFGQSANGQWRNSTPASGSAPQKPRNSRSLCL
ETRKTSSGLSNTFVGKSNHHCHMSAYEKSFPIKPAPSPSWSGSCRRSLLSPKKTQRRHFS
TAEETVQEEEKEIYRQLLQMVTGKQFCVAKPTTHFPLRLSRCLSSNKNSLKDSLLRNGNS
CASHVIGSDTSSSGSASILTAQEQLSHSAHSLSSGTPDVAFGSKDSDPHHHLAAPHQPNS
LPASNTQSEGSDSVILLKVKESQTPASSPTFFQAELWIKELTSVYDSRARERLRRIEEQK
ALALQLQNQRLQEQEHAVLDSVELHLRVPLEKEIPVTAAQETRKKSHQLTDSEDEFPEIT
EEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKE
KGFPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRRK
SITYYDSMGGINNEACRILLQYLKQESVDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCG
MFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggatgacacagctgatggggtgaagatggacgctggggaggtgaccttagtgaaccac
ggctccactttcagaacccaccgcccgccacagtcaggctttccagaggagcagcttctg
ctttctgaccagcagagcttgcctttcaggcagggtactttagatggatctttcacgtgt
tctacaagaagcccagcctatcgtccagattatcactcagataacccttcctcagacagt
ttccttggctcaggtgacgtaagaacctttggtcaaagtgcaaatggacaatggagaaat
tccactccagcgtcaggctcagcgccacaaaaaccaagaaatagccgaagtctttgcctc
gaaacccggaagacctcaagtggattatcaaacacctttgtgggcaagtccaatcaccac
tgccacatgtctgcgtatgaaaagtcatttcccattaagcctgccccaagtccatcctgg
agtgggtcatgtcgtcggagtcttttaagccctaagaaaactcagaggcgacatttcagc
acagcagaagagacagttcaagaagaagagaaggagatctacagacagctgctgcagatg
gtcacagggaagcagttctgtgtagcgaaacccaccacacattttccgttacgcctgtct
cggtgtcttagttccaataagaactctttgaaagactcgctgttgagaaacggaaactct
tgtgcatctcatgtcattggttctgatacgtcatcctctggatctgccagcattttaact
gcacaggagcagttgtcccacagtgcacattccctgtcatctggtaccccagatgttgcc
tttggatccaaagactctgatcctcaccatcacctcgctgcacctcatcagccaaatagc
ttaccagcatcaaatacacagtccgaagggtcagactctgtgattttacttaaagtgaaa
gaatctcagactccagcttccagccctacgttcttccaggcagagctatggatcaaagaa
ttaactagcgtttatgactctcgagctcgggaaagattgcgccggattgaagagcagaaa
gcattggcactacagcttcaaaaccagcgactgcaggagcaggaacatgcagtacttgac
tccgtagagcttcaccttcgtgtgcctcttgaaaaggagattcctgtcacagctgcccaa
gaaaccaggaaaaaaagccaccagctgactgacagtgaagacgaatttcctgaaattaca
gaggaaatggaaaaagaaataaagaatgtatttcgtaacggtaaccaggatgaagtcctc
agtgaggcattccgcttgaccattacacgcaaagacattcagactctaaaccatctaaac
tggctcaatgatgagatcatcaatttctacatgaacatgctaatggaacgcagtaaagag
aaggggtttccaagtgtacatgcgtttaataccttcttcttcactaagctaaaaacagct
ggttatcaggcagtgaaacgctggacaaagaaggtggatgtattctccgttgatattctt
ctggtgcccattcacttgggtgtgcactggtgtctagctgttgtagactttagaaggaag
agtatcacctactatgattctatgggtggaataaacaacgaggcctgcaggatcctcttg
caatacctaaaacaagaaagtgttgacaagaaaaggaaagagtttgacaccaacggctgg
cagctcttcagcaagaagagccaggaaatcccacagcagatgaatgggagtgactgtgga
atgtttgcttgcaaatatgctgactgcattaccaaagacagaccaatcaacttcacacag
caacacatgccatatttccgaaagcgaatggtctgggagatcctccaccggaagctcttg
tga

DBGET integrated database retrieval system