KEGG   Mus musculus (house mouse): 22390
Entry
22390             CDS       T01002                                 
Symbol
Wee1, Wee1A
Name
(RefSeq) WEE 1 homolog 1 (S. pombe)
  KO
K06632  wee1-like protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    22390 (Wee1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    22390 (Wee1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    22390 (Wee1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22390 (Wee1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     22390 (Wee1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  WEE family
   22390 (Wee1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    22390 (Wee1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 22390
NCBI-ProteinID: NP_033542
MGI: 103075
Ensembl: ENSMUSG00000031016
UniProt: P47810
Position
7:109721266..109742506
AA seq 646 aa
MSFLSRQQPPPTRRVGAAYSLRQKLIFSPGSDCEEEEEEEEEGSGHSTGEDSAFQEPDSP
LPSARSPAEAEAERRRRSPGAEPSSPGELEDDLLLQGGGGGAQAAGGGAEGDSWEEEGFG
SSSPVKSPSTAYFLSSPFSPVRCGGPGDASPQGCGAPRAMDDPCSPQPDYPSTPPHKTFR
KLRLFDTPHTPKSLLSKARVIDSGSVKLRGSSLFMDTEKSGKREFDTRQTPQVNINPFTP
DPVLLHSSGRCRGRKRAYFNDSSEDMEASDYEFEDETRPAKRITITESNMKSRYTTEFHE
LEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHPHVVR
YFSAWAEDDHMLIQNEYCNGGSLADAISENYRVMSYLTEVELKDLLLQVGRGLRYIHSMS
LVHMDIKPSNIFISRTSIPNAVSEEGDEDDWISNKVMFKIGDLGHVTRISSPQVEEGDSR
FLANEVLQENYSHLPKADIFALALTVVCAAGAEPLPRNGEQWHEIRQGRLPRIPQVLSQE
VTELLRVMIHPDPERRPSAMELVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKA
QMAAKVAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgagcttcctgagccgacagcagccgccgcccacccgccgcgtaggagccgcttacagt
ctgcggcagaagctcatcttctcgccgggcagcgactgtgaggaagaggaggaggaggag
gaggaaggcagcggccacagtacgggggaggactcggccttccaggaaccggattcgccc
ctgccttctgcacgcagccctgccgaggccgaggccgagcgccgccgtcgctcgcccggc
gcggagcccagcagcccgggagagctggaggacgacttgctgctgcagggcggcggcgga
ggcgcgcaagcggcgggtggaggcgccgagggcgactcttgggaggaggagggtttcggc
tcctcgtcgcccgtcaaatcaccttcgaccgcctactttctgagcagcccgttctcgcca
gtgcgctgcggcggcccaggggatgcctccccgcagggttgcggggctccgcgagccatg
gacgacccctgctcgccgcagcccgactacccgagcacccctccgcacaagaccttccgc
aagctgcgcctgttcgacacgccgcacactcccaagagtttgctttccaaagcgcgagtt
attgattccggctctgttaaactccggggtagttctctattcatggacacagaaaagtca
ggaaaaagagaattcgatacacggcaaactccccaagtgaatattaacccctttactccg
gatcctgtactgctccattcctcaggacggtgtcgtgggagaaagagagcgtattttaat
gattcctctgaagacatggaagccagtgattatgagtttgaagatgaaacaagacctgcc
aaaagaattacaattactgaaagcaacatgaagtcacggtatacaactgaatttcatgag
ctggagaaaattggttctggagaatttggttctgtgtttaaatgtgtgaagaggttagat
ggatgcatttatgccattaaacgatcaaaaaaaccattggctggctctgttgatgagcag
aatgctttgagagaagtgtatgctcacgctgtgcttggacagcacccccacgtcgttcgc
tatttctctgcctgggcagaggatgaccacatgcttatacagaacgaatactgtaatggt
gggagtttagctgatgctataagtgagaactacagagtcatgagctacttgactgaagta
gagctgaaggatctccttttgcaagttggccggggcttgagatacatacattcaatgtct
ttggttcacatggatataaaacctagtaatatttttatatctcgaacctcaatcccaaat
gctgtctctgaggaaggagatgaagatgactggatatccaataaagttatgtttaaaata
ggtgatcttgggcatgtaacaagaatctctagtcctcaagttgaagaaggtgatagtcgt
tttctagcaaatgaagttttacaagagaactatagccatctaccgaaagcagatattttt
gctcttgctctcacagtcgtatgtgctgctggtgctgaaccccttcccagaaatggagag
cagtggcacgagatccggcagggtcggttacctcggatcccacaagtgctttcccaggag
gtgacagagttgctgagagtcatgattcatcctgacccagagagaaggccttcagcaatg
gagctggtgaagcattcagtgttgttgtctgcatctagaaagagcgcagagcagttacga
atagaattgaatgctgaaaaattcaaaaattctcttttgcagaaagaactcaagaaagcc
caaatggcagccaaagttgcagctgaggaacgggcactcttcacagatcggatggccact
agatccaccacccagagtaatagaacttctcgacttattggaaagaaaatgaaccgctct
gtcagccttactatatactga

DBGET integrated database retrieval system