KEGG   Mus musculus (house mouse): 223915
Entry
223915            CDS       T01002                                 
Symbol
Krt73, BC067067, CK-73, K73, Kb36
Name
(RefSeq) keratin 73
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    223915 (Krt73)
   04147 Exosome [BR:mmu04147]
    223915 (Krt73)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     223915 (Krt73)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   223915 (Krt73)
  Exosomal proteins of other body fluids (saliva and urine)
   223915 (Krt73)
  Exosomal proteins of colorectal cancer cells
   223915 (Krt73)
  Exosomal proteins of bladder cancer cells
   223915 (Krt73)
SSDB
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip TPR_MLP1_2 ADIP DUF5082 Taxilin Jnk-SapK_ap_N ATG16 ATG17_like Golgin_A5 Bap31_Bap29_C Baculo_PEP_C DUF1664 Alanine_zipper DUF4140
Other DBs
NCBI-GeneID: 223915
NCBI-ProteinID: NP_997650
MGI: 3607712
Ensembl: ENSMUSG00000063661
UniProt: Q6NXH9
Position
15:complement(101701739..101710795)
AA seq 539 aa
MNRQFTCKPGVANRGFSGCSAVLSGGSSSSYRAAGKGLSGGFSSRSLYSLRSPRSISFNV
ASSSGRTGGYGFGRNRASGFAGSMFGSGALGPSNPSLCLPGGIHQVTVNKSLLAPLNVEL
DPEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLQTKWELLQQLDLSNCRRNLEP
VYEAHISSLQKQLDSLSGDRVRLDSELRGMRDAVEDCKKRYEEEINKRTTAENEFVVLKK
DVDAAYMSKVELQAKVDALDGEIKFLKCLYEGEITQMQSHISDTSVVLSMDNNRNLDLDS
IIAEVRAQYEDIALKSKAEAEMVYQTKFQELQLAAGRHGDDLKHTRNEISELTRLIQRLR
SEIESVKKQCSNLETAIADAEQRGDCALKDARAKLDELERALHQAKEELARMLREHQELM
SMKLALDIEIATYRKLLEGEECRMSGEHTSAVSISVISSSAPGTVGAGTSFGFSSAGTYG
YRQSSVAGGYGILSGGCVTGSGNCSPRGDTKNRLGSASEFKEVSGKTLALGSPSKKTMR
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgaatcgccaattcacctgcaaacctggagttgccaacaggggcttcagcggctgctca
gctgtgctctccggaggcagctcatcctcttaccgggcagccggcaaagggctcagtgga
ggcttcagcagtcggagcctctacagcctgaggagtcccaggagcatctccttcaatgtg
gctagcagcagcgggcgcacagggggatatgggtttggccggaatcgggccagtggcttt
gctggcagtatgtttggcagtggggctctggggccttcaaatccatccttgtgcctgcct
ggaggcatccaccaggtaacagtcaataaaagcctcctggctcctctcaatgtggagctg
gacccggagatccagaaggtgcgcgcccaggagcgggagcagatcaaggctctgaacaac
aaattcgcctccttcatcgacaaggtgcgcttcttggagcagcagaaccaggtgctgcag
accaagtgggagctgctgcagcagctggacctgagcaactgcaggaggaacctggagcct
gtttatgaggcccacatcagcagcctgcaaaagcagctggattcgctatctggggacagg
gtgaggctggactcggagctgaggggcatgcgggatgcagtggaggactgcaagaagagg
tatgaagaagaaataaacaagcgtacaactgctgagaatgaatttgtagtgcttaagaag
gatgtggatgccgcatacatgagcaaggtggagcttcaggccaaggtggacgccctggat
ggagagatcaaattcctcaagtgtctgtatgagggggagattactcagatgcagtcccac
ataagtgacacctctgtggtcctgtccatggacaacaaccgcaacctggacctggacagc
atcatcgctgaggtccgagctcagtacgaggacattgccctgaagagcaaggcagaggct
gagatggtgtaccagaccaagttccaagagctgcagctggcagctggccggcacggagat
gacctcaagcacaccaggaatgagatctctgagttgacccggctcatccagagactgcga
tcagaaatcgagagtgtgaagaagcaatgttccaatctagagacagccattgctgatgct
gagcagcgaggtgactgtgccctcaaggatgcccgggccaagctggatgagctggagaga
gccctgcaccaggctaaggaggagctggcccggatgctgcgtgagcaccaggagctgatg
agtatgaagctggccctggacattgagatcgccacctaccgcaagctgctggagggggag
gagtgcaggatgtctggagaacacaccagtgctgtgagcatttctgtcatcagtagttcc
gcacctgggacagtcggtgcggggaccagtttcggattcagtagcgctgggacctatggc
taccggcagagctctgtcgctgggggctatggcatactgtcagggggctgtgtcactggt
agtgggaactgcagcccccgtggagataccaagaacagactgggtagtgcaagtgaattt
aaggaggtttcgggaaagaccttggctttgggctcaccctcaaagaaaaccatgagataa

DBGET integrated database retrieval system