KEGG   Mus musculus (house mouse): 223917
Entry
223917            CDS       T01002                                 
Symbol
Krt79, BC031593
Name
(RefSeq) keratin 79
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    223917 (Krt79)
   04147 Exosome [BR:mmu04147]
    223917 (Krt79)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     223917 (Krt79)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   223917 (Krt79)
  Exosomal proteins of other body fluids (saliva and urine)
   223917 (Krt79)
  Exosomal proteins of colorectal cancer cells
   223917 (Krt79)
  Exosomal proteins of bladder cancer cells
   223917 (Krt79)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 Tropomyosin_1 Nuf2_DHR10-like HMMR_N CENP-F_leu_zip Taxilin GAS ADIP DUF4164 Ax_dynein_light ERM_helical
Other DBs
NCBI-GeneID: 223917
NCBI-ProteinID: NP_666175
MGI: 2385030
Ensembl: ENSMUSG00000061397
UniProt: Q8VED5
Position
15:complement(101837767..101848759)
AA seq 531 aa
MRSSLSRQTFSTKGGFSSNSASGGGGSRMRTSYSSVTMSRGSGGGGGVRSGSSSGGFGSR
SLYNLGGKNISVSMACGASSGRALGGFGSGAYVGLGASRQTFGPVCPPGGIQEVTVNQSL
LTPLNVEIDPEIQRVRTQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQSQN
TGVARSLEPFFENYLSTLRRQLDTKQSERGRLDMELRNVQDNLEDFKNKYEDEINKRTAL
ENEFVLLKKDVDAAYMGRMDLHGKVDSLTQEIDFLQQLFEMELSQVQTNVSDTNVILSMD
NNRNLDLDSIIAEVKAQYELIAQKSRAEAESWYQTKYEELQVTAGKHGDSLRDTKNEIAE
LTRTTQRLQGEVDAAKKQCQQLQTAIAEAEQNGEMALKDAKKKLGDLDTALHQAKEDLAR
MLREYQDLVSVKLALDMEIATYRKLLESEESRMSGDCPSAISISVTGNSTSVCAGGTAGF
GNGLSLGGAGGASKGGFGSSVSYGAAKGGQVSGGTSILRKTTTVKTSSRRY
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgcggtcctctttgtccaggcagactttctccactaaaggaggcttcagctctaactca
gccagcggaggtggtgggagtcggatgcgaaccagctacagctcagtgactatgtccagg
gggagcggcggtggcggtggggtccgctctgggtccagctccgggggctttggcagccgg
agcctctacaacttgggaggcaagaatatctccgtcagcatggcttgtggggcctcctct
ggccgggcactaggaggctttggcagtggggcctatgtgggcctaggggctagcaggcag
acatttgggccagtctgtcctcccgggggcatccaggaagtcactgtcaaccagagcctg
ctgacgcctctcaatgtggagatagaccccgagattcagcgggtgcgcacccaggagcgc
gagcagatcaagaccctcaacaacaagtttgcctcctttattgataaggtacgcttcctg
gaacaacagaacaaggtgctggagacgaagtgggcgctgctgcaggagcagagccagaac
acgggggtcgccaggagcctggagcctttctttgagaattacctgagcaccctgaggagg
cagctggataccaaacagagcgagcggggccggctggatatggagctgaggaacgtacag
gataatctggaggacttcaagaacaagtatgaggatgaaatcaacaaacgcactgccctg
gagaatgagtttgtgctgctcaagaaggatgtagatgccgcatacatgggcagaatggat
ctgcatggcaaagtggacagcttgacacaagagattgacttcctgcaacagctctttgag
atggagctgagccaagtgcagaccaatgtgtctgacaccaacgtgatactgtccatggac
aacaaccgcaacctggacttggacagcatcatcgctgaagtcaaagcccagtatgagctg
atcgcccagaagagtcgggctgaggctgagtcctggtaccagaccaaatatgaagaactg
caggtgacagctgggaagcacggggacagccttcgagacactaaaaatgagatcgcagaa
ctcactcgcaccactcagagactgcagggcgaggtggatgcagccaagaagcagtgccag
cagctgcagacagccatcgcagaagcagagcagaatggggagatggcgctcaaggacgct
aagaagaagcttggagatctagacacagccctgcatcaggccaaggaggacctggcccgg
atgctgcgtgaataccaggatcttgtgagcgtcaagctggccctggatatggagatcgcc
acctaccgcaagctgctggagagcgaggagagcaggatgtctggagattgtcccagcgca
atcagcatctcggtgaccggcaactctacctccgtttgcgcaggcggcacggctggcttc
gggaacggcctctctctgggcggggctggcggggccagcaagggcggctttggttctagt
gtgagctatggcgctgccaaaggcggtcaggtctctgggggaacctccatcctacggaag
accactacagtcaagacctctagccggagatactag

DBGET integrated database retrieval system