KEGG   Mus musculus (mouse): 223921Help
Entry
223921            CDS       T01002                                 

Gene name
Aaas, AAA, ADRACALA, D030041N15Rik, GL003
Definition
(RefSeq) achalasia, adrenocortical insufficiency, alacrimia
  KO
K14320  aladin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Module
mmu_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    223921 (Aaas)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    223921 (Aaas)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     223921 (Aaas)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 WD40 PD40 WDCP
Motif
Other DBs
NCBI-GeneID: 223921
NCBI-ProteinID: NP_700465
MGI: 2443767
Ensembl: ENSMUSG00000036678
UniProt: P58742 Q8BU75
Position
15; 15 F3
AA seq 546 aa AA seqDB search
MCSLGLFPPPPPRGQVTLYEHNNELVTGNSYESPPPDFRGQWINLPVLHLTKDPLKAPGR
LDHGTRTAFIHHREQVWKRCINVWHDVGLFGVLNEIANSEEEVFEWVKTACSWALALCGR
ASSLHGSLFPHLSLRSEDLIAEFAQVTNWSSCCLRVFAWHPHTNKFAVALLDDSIRVYNA
NSTIVPSLKHRLQRNVAALAWKPLSASVLAVACQSCILIWTLDPTSLSTRPSSGCAQVLS
HPGHTPVTSLAWAPNGGWLLSASPVDAVILVWDVSTETCVPLPWFRGGGVTNLLWSPDGS
KVLATTPSAVFRVWEAQMWTCEAWPTLSGRCQTGCWSPDGNRLLFTVLGEALIYSLSFPE
RCGTGKGHVGGAKSATIVADLSETTIQTPDGEERLGGEAHSMVWDPSGERLAVLMKGNPQ
VQDGNPVILLFRTRNSPVFELLPCGIIQGEPGAQAQLITFHPSFNKGALLSVCWSTGRIT
HIPLYFVNAQFPRFSPVLGRAQEPPAGGGGSIHEVPLFTETSPTSAPWDPLPGQSSAQPH
SPHSHL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtgctccctggggttgttccccccgccgccgcctagaggtcaagtcaccctgtatgag
cacaataacgagctggtgaccggcaacagctatgagagcccgcctcccgactttcggggc
cagtggatcaatcttcctgtcctacacctgaccaaggatcccctaaaagccccagggagg
ctggaccatggtacaagaactgccttcatccatcaccgtgagcaagtgtggaagagatgc
atcaatgtttggcatgatgtgggcctttttggcgtcctgaatgaaattgcgaattcagag
gaagaagtgtttgagtgggtaaagacagcctgcagctgggccctggctctctgtggccgc
gcctcctcactccatggctccctgtttccacacctctctctcaggagtgaagatctgatt
gctgaatttgcccaagtaactaactggtccagctgctgcttacgggtctttgcctggcat
cctcacaccaacaagtttgcagtggccctgctggacgactccatccgtgtttataatgcc
aacagcactatagttccctccctgaagcaccgtctgcagcgaaatgtagcagccttggcc
tggaagcccctcagtgcctctgtcttggctgtggcctgccagagctgtattctcatctgg
accctagaccccacttccttatctacgagaccctcctctggctgcgcccaggtgttgtct
caccctgggcacacaccagtcactagcttggcttgggcccccaatggggggtggctgctc
tcagcctcacctgtagatgctgttattctggtatgggacgtttcaacagagacttgtgtc
ccccttccttggttccgaggaggaggggttaccaatctgctgtggtccccagatggcagc
aaagtcctggctactactccttctgccgtctttagagtctgggaggcccagatgtggact
tgtgaggcgtggccaactctttcagggcgctgccagactggctgctggagtccagatgga
aaccgactgctgttcactgtattgggggaagcattaatttattccttgtcattcccagaa
cgatgtggaacagggaaaggacatgttggaggtgcaaagtcagcaaccatcgtagcagat
ctttctgagacaacaattcagaccccagatggagaggagagactcgggggagaggcccac
tccatggtgtgggacccaagtggtgaacgtctggctgtgctcatgaaaggaaacccacag
gttcaggacgggaatcctgtcatcctcctttttcgaactcgaaacagccccgtgtttgaa
ctgcttccctgtggtattattcagggggaaccaggagcccaagctcagctcatcactttc
catccttccttcaacaaaggggccttgcttagtgtgtgctggtccacaggccgaatcacc
cacatacctctgtactttgtcaatgctcagtttccacgctttagcccagtacttggtcga
gcccaggagcctccagctggagggggaggctctattcatgaagtgccactatttactgag
acatcaccaacctctgctccttgggaccctcttccaggacaatcatctgctcaaccccac
tcccctcattcccacttgtaa

DBGET integrated database retrieval system