KEGG   Mus musculus (mouse): 22393
Entry
22393             CDS       T01002                                 

Gene name
Wfs1, AI481085, wol, wolframin
Definition
(RefSeq) wolframin ER transmembrane glycoprotein
  KO
K14020  wolfamin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22393 (Wfs1)
SSDB
Motif
Pfam: HTH_16
Other DBs
NCBI-GeneID: 22393
NCBI-ProteinID: NP_035846
MGI: 1328355
Ensembl: ENSMUSG00000039474
Vega: OTTMUSG00000035647
UniProt: P56695 Q3UN10 Q3TDI2
Position
5; 5 B3
AA seq 890 aa
MNSGTPPPSPSGPPPPPAPQPQARARLNATASLEQDKIEPPRAPRPQADPSAGRSAGEAA
APEPRAPQTGSREETDRAGPMKADVEIPFEEVLEKAKAGDPKAQTEVGKHYLRLANDADE
ELNSCSAVAWLILAAKQGRREAVKLLRRCLADRKGITSENEAEVKQLSSETDLERAVRKA
ALVMYWKLNPKKKKQVAVSELLENVGQVNEQDGGAQPGPVPKSLQKQRRMLERLVSSESK
NYIALDDFVELTKKYAKGIIPTNLFLQDEDEDEDELAGKSPEDLPLRQKVVKYPLHAIME
IKEYLIDVASKAGMHWLSTIVPTHHINALIFFFIISNLTIDFFAFFIPLVVFYLSFVSMV
ICTLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNFGWNHLEPYIHFLLSVVFVIFS
FPLASKDCIPCSELAVISTFFTVTSYMSLSSSAEPYTRRALVTEVAAGLLSLLPTVPVDW
RFLKVLGQTFFTVPVGHFIILNVSLPCLLYVYLFYLFFRMAQLRNFKGTYCYLVPYLVCF
MWCELSVVILLQSTGLGLVRASIGYFLFLFALPILVAGLALMGTVQFARWFLSLDLTKIM
VTTVICGVPLLFRWWTKANFSVMGMVKSLTKSSMVKLILVWLTAILLFCWFYVYRSEGMK
VYNSTLTWQQYGFLCGPRAWKETNMARTQILCSHLEGHRVTWTGRFKYVRVTEIDNSAES
AINMLPFFLGDWMRCLYGEAYPSCSSGNTSTAEEELCRLKQLAKHPCHIKKFDRYKFEIT
VGMPFGTNGNRGHEEDDITKDIVLRASSEFKDVLLNLRQGSLIEFSTILEGRLGSKWPVF
ELKAISCLNCMTQLSPARRHVKIEQDWRSTVHGALKFAFDFFFFPFLSAA
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgaactcaggcaccccacctccgagcccctctggcccacctcctccacccgcaccacag
ccccaggcccgggcccggctcaatgccaccgcctcactggagcaggacaagattgaaccg
cctcgtgctcccagacctcaggctgaccccagtgctggacgaagtgctggggaagcagcc
gctccggagcctcgggcccctcaaaccggcagccgggaagaaacggacagagctggtccc
atgaaggcagatgtggagatcccctttgaagaagtcctggagaaagccaaggctggagac
cccaaagcacagactgaggtgggcaaacactacctacgccttgccaacgatgcagatgaa
gaactcaacagctgctcagccgtagcctggctaatcctggcagccaagcagggcaggcgg
gaggccgtgaagctgctgaggcggtgcctagctgaccggaaaggcatcacttctgagaac
gaggctgaggtgaagcagctatcctctgagaccgacctggaaagggctgtgcgcaaggct
gccctggtcatgtactggaaactcaaccccaagaagaagaagcaggtggctgtgtccgag
ctgctggagaatgttggacaggtcaacgagcaggatggaggggcgcagccaggcccagtc
cccaagtccctgcagaagcagaggcgcatgctggagcgcctcgtcagcagtgaatccaag
aactacattgctctggacgattttgtggagctcaccaagaagtacgccaagggcatcatt
cccaccaacctgttcctgcaggatgaggatgaagatgaggacgagctggcagggaagagc
cccgaggacctgccactacgccagaaggtggtgaagtaccctttacacgccatcatggag
atcaaagagtacctgattgacgtagcctccaaggccggcatgcactggctctccaccatt
gtacccacccatcacatcaacgccctcatcttcttcttcatcatcagcaacctaaccatc
gacttcttcgccttcttcatccccctggtggtcttctatctgtcctttgtgtccatggtc
atctgcacgctcaaggtgttccaggacagcaaggcctgggagaacttccgtactctcacc
gacctgctgctgcgcttcgagcccaacctagacgtggagcaggccgaagtgaacttcggc
tggaaccacctggagccctacatccacttcctactgtcagtcgtctttgtcatcttctcc
ttcccgctggccagcaaggactgcatcccctgctcggagctggccgtcatctccaccttc
ttcacggtgaccagctacatgagcctgagcagctctgctgagccctataccaggcgtgcc
ctggtcaccgaggtggctgccggcttgctgtcccttctgcccaccgtgcctgtggactgg
cgcttcctgaaagtactcggccagactttcttcactgtgcccgttggccacttcatcatc
ctcaacgtcagcctcccctgcctgctctatgtctatctcttttacctcttcttccgcatg
gcccagctgaggaacttcaagggcacttattgctacctggtgccctacctggtgtgcttc
atgtggtgtgaactgtccgtggtcatcctgctccagtctaccggcctgggcttggtccgg
gcctccatcggctacttcctcttcctctttgccctccccatcctggtggctggcctcgcc
ttgatgggcacggtgcagtttgcccgatggttcctgtcgctggacctcaccaagatcatg
gtcaccacggtgatctgcggcgtacccctgcttttccgttggtggaccaaggccaacttc
tcagtgatggggatggtcaagtccctgacgaagagctccatggtgaagctcattctggtg
tggctaacggccatcctgctcttctgctggttctacgtgtaccgctcagaaggcatgaag
gtctacaactccacactcacctggcagcaatatggcttcctatgtgggccccgggcctgg
aaggaaactaacatggcccggacccagatcctgtgcagccacctggagggccacagggtc
acgtggacaggccgcttcaagtatgtccgagtgaccgagatcgacaacagtgctgagtcg
gccatcaacatgctcccgttcttcctgggcgattggatgcgctgcctgtatggcgaggcc
tacccatcttgtagctctggtaacacgtccacggcagaggaggagctctgccgtctcaag
cagctggccaagcacccctgccacatcaagaagtttgaccgctacaaatttgagatcaca
gtgggcatgccctttggcaccaacggcaaccgcggccatgaagaggacgacatcaccaag
gacattgttctccgtgccagcagcgagttcaaggacgtgctgctgaacctgcgccagggg
agcctcatagagttcagcaccatcctcgagggccgcctgggtagcaagtggcccgtcttc
gagctcaaggccatcagctgcctcaactgcatgacgcagctgtcacctgcccggaggcac
gtgaagatcgaacaggactggcgtagcacagtgcacggtgccctcaagtttgccttcgac
ttcttcttcttcccattcctgtctgccgcctga

DBGET integrated database retrieval system