KEGG   Mus musculus (house mouse): 224008
Entry
224008            CDS       T01002                                 
Symbol
Spidr, 2310008H04Rik, Kiaa0146
Name
(RefSeq) scaffolding protein involved in DNA repair
  KO
K22806  DNA repair-scaffolding protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    224008 (Spidr)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     224008 (Spidr)
SSDB
Motif
Pfam: DUF4502 DUF4503
Other DBs
NCBI-GeneID: 224008
NCBI-ProteinID: NP_666180
MGI: 1924834
Ensembl: ENSMUSG00000041974
UniProt: Q8BGX7
Position
16:complement(15707088..15964715)
AA seq 933 aa
MSGARRPGTSKRKRNWHIEHPSFREERSQQLRRGNFKTVEAADSLSKAWLKCGEGFQDTS
EILSLASEKTGITEKHLELSPKPKTETTSKNASELPNIIWSSSESDFSDEDKTLPALQRD
GRHGPRADRLGDRTISCPEDEDIEDELQVIDWEVNSDKEDPGGPSECEDDKGTLDISDCD
SCASLTSDDRLCEPSEPISTEILEYSSDSEKEEDPEHSLFIDSESPHKYQADFKSDARWC
LVSQTDSEANSAEPTLTPQKYTVKFPKTPEYSVTKKKLLRGGLAERLQELQNRKRSAISL
WRHRCVSYQMTPLGRKSGVLTVKILELHEECSMQVAVCEQLAGPPITSPPGGLAPRPGAY
LKVLFTRETADHLMGHPQDIIYIFPPWQKLLIPNGSCSIILNTYFCQKAIAKETVREDLY
SPDISLSRRNITLAQTFRIKDITDNSSINQTTYDSLATPGTGWTHGHEKAEQHLIVAAPL
RNSLLDIVESQRAGLWSGVRVQVVVQRVYSLLSRDGARSQQGHTVGHADASGAWSCLLVQ
DACGMFGEVFLNSTLWKSRQLEGKSCSMSGVKVLQKATRGRTPGLFSLIDSLWPPVISLT
EPSCGQPSGETKTYLPPPIFCYIFSAHPTLGQIDAIEDHISKLYQPPVVRCLKEILQTNE
CSTRCSFYARVIYQKPQLKNLLAQKEIWLLVTDITLQTQDERDHSLPKTLPVYIAPSCVL
GPEVVEELALLVSYNLLFRDAFKDNGQIVCIERTVILPQKPLLCVPSASCDLPSPVTLDE
LSALTPVNSICSVQGTVVDVDESTAFSWPVCDRCGNGRLEQKPEDGGTFSCGDCSQLVLS
PLQERHLHVFLDCPTRPESTVKVKLLESSISLLLMSAASEDGSYEVESVLGKEMGPLLCF
VQSITTQQSSCVVTLEEIELLSTEGATAAQPPP
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgtctggagcccgccgccccggcacgtccaagaggaaaaggaattggcatatagaacac
ccatcctttcgagaagagaggtcacagcagttgagacggggaaatttcaagacagtggaa
gcagctgactctctctctaaagcatggctcaagtgtggagaaggatttcaggacacctct
gagatcctgtcattagcaagtgaaaagacaggtattactgaaaagcacctggaattatct
ccaaaaccaaagacagaaactacaagtaagaatgctagtgagcttccaaatataatatgg
agttccagtgaaagtgatttctccgatgaagataagacacttcctgcattacagagagat
ggtaggcatggccctagagccgacaggcttggtgacaggactatctcatgtcccgaagac
gaagacattgaagatgaattacaggttattgactgggaggttaacagtgacaaagaagat
cctggtgggcctagtgagtgtgaagatgataagggtaccctggacatctcagattgtgat
tcctgtgcaagtctgacaagtgatgacaggctatgtgagccttctgagccaatttctaca
gaaattttggagtattcatcagatagtgaaaaagaagaagacccagaacattccctgttc
attgattcagaatcccctcacaaataccaggcggattttaaatctgatgcaagatggtgt
ttggttagtcagactgactcagaagcaaattcagctgagcctacattgacaccccagaaa
tatacggtcaagtttccgaagactccagaatattcagtaacaaagaagaagcttttaagg
ggcgggctagcagaaagactccaagaactgcagaatcgaaagagatctgccatttctttg
tggagacatcgatgtgtttcttaccaaatgacaccattaggcagaaaatctggtgtatta
actgtgaaaattctagaactgcatgaggaatgcagcatgcaagttgcagtatgtgagcag
ttagcagggcctccaatcaccagccctcccggaggactagctcctagaccaggagcctac
ctgaaggtactcttcaccagagagactgcagaccacttgatggggcatccccaggacatc
atttacatcttccctccttggcaaaaacttcttatcccaaatggaagttgctccattatt
ctgaatacttatttttgtcagaaagctattgcaaaagaaacagtgcgcgaagacctatac
agtccggacatatctctttcaaggagaaatataactttggcccagacatttagaattaag
gacataacagacaattcatccatcaatcagactacatatgatagcctggccacccctggc
acaggctggacccacggacatgagaaggcagagcaacatcttatagttgctgctcccctg
aggaattctcttctggacattgtggaaagccaaagagctggcctatggtctggagtcagg
gtccaagtagtagtgcagagggtgtactctcttctcagcagagatggtgccaggagccag
caagggcacacagtgggacatgcagatgcctctggagcatggtcctgccttctagtgcag
gatgcctgtggcatgttcggggaagtgttcttgaacagcaccctctggaagagcagacag
ttagaagggaagtcctgcagcatgtcgggagtgaaggttctacagaaagctacaagagga
aggacaccagggctcttcagtttaattgacagtttgtggcccccagtgatatctctgact
gagccttcctgtggccagcccagtggagagacaaagacttatctgcctcctcctatcttc
tgttatatcttctctgcacatccaacactgggacaaattgatgcaattgaagaccacatt
tccaagctttaccagcctccagttgtccgctgcttaaaagaaatcctccagactaatgag
tgcagtacacgttgcagcttctatgccagagtgatttatcaaaaaccacagctaaagaat
cttttggcgcaaaaggaaatctggctgctggtgactgacatcactctgcaaacacaggat
gaaagggaccactctcttcccaaaaccctgcctgtctatatagccccctcgtgtgtgctg
ggcccagaggttgtagaagaacttgccttgctggtgtcttataacttactcttcagggac
gcttttaaggacaacggtcagattgtttgtattgaacggacagtcatcctaccccagaaa
cctctcttgtgtgtaccttctgcttcctgtgacttgcccagcccagtgacactggatgaa
ctgagtgccctcacacctgtcaactccatttgcagtgtgcaaggtactgtggttgatgta
gatgagagcactgctttctcgtggcctgtgtgtgaccggtgtggcaatgggagactggaa
cagaagccagaagatggaggcaccttctcctgtggggactgttcccaactggtcctgtca
cctcttcaagagaggcacctgcatgtctttctggactgtcccacgagacctgagagtact
gtgaaggtcaagctattggagagcagtatttctttacttctgatgtctgctgcctctgag
gatgggagttatgaagtggagagcgtccttgggaaggagatgggacctttactctgcttt
gtccagtccatcactacacagcagagcagctgtgtcgtcaccctggaagagattgagctg
ctgagtacagagggagccactgctgctcagcctcctccctga

DBGET integrated database retrieval system