KEGG   Mus musculus (house mouse): 22401
Entry
22401             CDS       T01002                                 
Symbol
Zmat3, Wig1
Name
(RefSeq) zinc finger matrin type 3
  KO
K10137  zinc finger, matrin type 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    22401 (Zmat3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 22401
NCBI-ProteinID: NP_033543
MGI: 1195270
Ensembl: ENSMUSG00000027663
UniProt: B9EI21
Position
3:complement(32388941..32419814)
AA seq 290 aa
MILLQQVWLPLPNRPSTSPPMSVAARSTRTLQLPPQKAFGQEASLPLAGEEDLAKRGEPD
SALEELCKPLFCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARVSSVVAEP
VATPLVPVPPQVGSCKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAE
AQSHSFSDSAEAGQRRTRKEGSEFKMVATRRNMYPVQSNSGPYFNARSRQRIPRDLAMCV
TPSGQFYCSMCNVGAGEEVEFRQHLESKQHKSKVSEQRYRSEMENLGYVQ
NT seq 873 nt   +upstreamnt  +downstreamnt
atgattcttttgcagcaggtctggcttcctttacctaatcggccttcaacctctcctcct
atgtcagtggctgccaggtccacaaggaccttgcagctcccgccacagaaggcttttggg
caggaagcatccttgcctctggcaggggaagaggatttagctaagagaggggagccagac
tctgccctggaggagctgtgtaagcccctcttctgcaaactctgcaatgtcaccttgaac
tccgctcagcaagcccaggcacactatcagggtaaaaaccatggcaagaaactacgaaat
tattacgcagctaacagctgtcctcctccagccagggtgagcagcgtggtggcagagcct
gtagccacacccctcgttcctgtccctccgcaggtgggctcctgcaagccagggggcagg
gtgatcctggctacagagaatgactactgtaagctgtgcgatgcctccttcagctcccct
gccgtggcacaggcgcactaccaggggaagaaccatgccaagagactccgtctggccgaa
gctcagagtcactcattctcggactccgcagaggcagggcaacggcggactcggaaagaa
gggagtgaatttaagatggtggccaccaggaggaatatgtatccagtccagagcaattca
ggcccttacttcaatgcccgctcccggcagaggatcccgcgagatctcgccatgtgcgtg
actccaagtggccagttttactgctccatgtgtaacgttggggctggcgaagaggtggag
ttccggcagcatctagagagcaagcagcacaaaagcaaggtgtccgagcagcggtacagg
agcgagatggagaacctgggctacgttcagtga

DBGET integrated database retrieval system