KEGG   Mus musculus (mouse): 22403Help
Entry
22403             CDS       T01002                                 

Gene name
Ccn5, Crgr4, Ctgfl, Rcop1, Wisp2
Definition
(RefSeq) cellular communication network factor 5
  KO
K23089  WNT1-inducible-signaling pathway protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    22403 (Ccn5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGFBP VWC
Motif
Other DBs
NCBI-GeneID: 22403
NCBI-ProteinID: NP_058569
MGI: 1328326
Ensembl: ENSMUSG00000027656
Vega: OTTMUSG00000001174
UniProt: Q9Z0G4 A2AHD1
Position
2; 2 H3
AA seq 251 aa AA seqDB search
MRGNPLIHLLAISFLCILSMVYAQLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRL
GESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVL
CRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGH
QLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLA
SRSHGSWNSAF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcaacccactgatccatcttctggccatttccttcctctgcattctctcaatg
gtgtatgcccagctgtgcccagcaccctgtgcctgtccttggacaccaccccagtgccca
ccgggggtacccctggtgctggatggctgtggctgctgtcgagtgtgtgcacggaggctg
ggggagtcctgcgaccacctgcatgtctgcgaccccagccagggcctggtttgtcagcct
ggggcaggccccagtggccgtggtgctgtgtgcctcttcgaagaggatgacgggagctgt
gaggtgaatggccgcaggtacctggatggggagacctttaaacccaattgcagggttttg
tgccgctgtgatgacggtggtttcacctgcctgccgctgtgcagtgaggatgtgcggctg
cccagctgggactgcccacgccccaggagaatacaggtgccaggaaggtgctgccccgag
tgggtgtgtgaccaggcagtgatgcagccggcaatccagccctcctcagcccaaggacac
caactttctgcccttgtcactcctgcatctgccgatggcccctgtccaaactggagcaca
gcctggggcccctgctcaaccacctgtgggttgggcatagccacccgagtatccaaccag
aaccgattctgccaactggagatccagcgtcgcctgtgtctgtccagaccctgcctggca
tccaggagccacggctcatggaacagtgccttctag

DBGET integrated database retrieval system