KEGG   Mus musculus (mouse): 224045
Entry
224045            CDS       T01002                                 

Symbol
Eif2b5, C81315
Name
(RefSeq) eukaryotic translation initiation factor 2B, subunit 5 epsilon
  KO
K03240  translation initiation factor eIF-2B subunit epsilon
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    224045 (Eif2b5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    224045 (Eif2b5)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    224045 (Eif2b5)
SSDB
Motif
Pfam: W2 Hexapep Fucokinase DUF4954 Hexapep_2
Other DBs
NCBI-GeneID: 224045
NCBI-ProteinID: NP_758469
MGI: 2446176
Ensembl: ENSMUSG00000003235
Vega: OTTMUSG00000025977
UniProt: Q8CHW4
Position
16; 16 A3
AA seq 717 aa
MAATAAVPGAAAGRASKRGGGGSGGGGTQGAEEEPPPPLQAVLVADSFNRRFFPISKDQP
RVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLQKSKWCHPTSPNVVRIIT
SELYRSLGDVLRDVDAKALVRSDFLLIYGDVISNINICRALEEHRLRRKLEKNVSVMTMV
FKESSPSHPTRCHEDNVVMAVDSATNRVLHFQKTQGLRRFSFPLSLFQGSGDGVEIRYDL
LDCHISICSPQVAQLFTDNFDYQTRDDFVRGILMNEEVLGNQIHLHVTTREYGARVSNLH
MYSAVCADVIRRWVYPLTPEVNFTDSTTQSYTHSRHNIYRGPEVSLGHGSVLEENVLLGA
GTVIGSNCSITNSVIGPNCHIGDNVVLDQAYLWQGVRVAAGAQIHQSLLCDRAEVKERVK
LKPYCVLTSQVVVGPDITLPEGSVISLHPPDAEEDEDDGQFSDDSGADQEKEKVKLKGYN
PAEVGLEGQGYLWKAEGVNSKEDEELRQSLWGLMIKTEEESETESEGSVDPEELDSRAGS
PQLDDIRVFQNEVLGTLQRGREENISCENLVLEINSLKHAYNISLKEVMQVLTLVVLEFP
LQQVDGLLDPNRYCALLLPLLKAWSPVLRNYIKRAADHLEALAAIEDFFLEHETLVTSMA
KVLMAFYQLEILAEETILSWFSQRDTTDEGQQLRKNQQLQRFIQWLREAEEESSEDD
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggcagccactgcggcggtgcctggcgctgcggccggccgagcgagcaaacgcggcggc
ggcggctcgggcggcgggggaacccaaggtgcggaggaggagccgccgccgcccctccag
gcagttctagtggccgatagcttcaaccgccgcttcttccccatctccaaggaccagcct
cgggtcctcttgcccctggccaacgttgcgctaattgactatactctggagttcctgact
gccacgggtgtacaggaaacatttgtcttttgctgctggaaagctgctcagatcaaagaa
cacttacagaaatccaagtggtgccatcctacgtcccccaacgttgttcggataatcaca
tcagagctataccgatcactaggagacgtcctccgtgacgtcgatgccaaggccttggtg
cgctctgactttctcttgatatatggagatgtcatctcaaatatcaatatctgcagagcc
ctggaggaacacaggttaagaaggaagctagaaaaaaatgtctctgtgatgacaatggtc
ttcaaagagtcgtcacccagccaccctacacgctgccatgaggacaacgtggtgatggct
gtggacagcgccaccaacagggttcttcacttccagaagacccaaggcctccggcgcttt
tcctttccattgagcctgttccagggcagtggagacggagtggagattcgatatgatttg
ttggactgtcacatcagcatctgctctcctcaggtagctcagctcttcacagacaatttt
gactaccaaactcgagatgattttgtacgaggcatattaatgaatgaggaggtcctagga
aaccagattcacttgcatgtgacaactagggaatatggtgcccgggtctccaacctacac
atgtactcagctgtttgtgctgacgtcatccgccgatgggtctaccctctcactccagaa
gtaaacttcactgacagcaccacccagagctacactcattcccgacacaacatctaccga
gggcctgaagtcagcctgggccatggcagcgtcctggaggaaaatgtgcttttgggagct
ggcactgtcatcggcagcaactgctccatcaccaacagtgtcatcggccctaactgccat
attggtgataatgtggtactggaccaggcctacctgtggcagggagttcgagtggctgct
ggagcacaaatacaccaatctctgctctgtgacagagctgaggtcaaggagcgagtcaaa
ctgaagccatactgtgttctcacttcccaggtggtagtgggcccagacatcacgctgccg
gagggctcggtgatctctttgcatcctccagatgcagaggaagatgaagatgatggccag
tttagtgatgattctggagctgaccaagaaaaggagaaagtgaagctgaaaggttacaat
ccagcagaagttggccttgaaggccagggatacctctggaaagctgagggtgtgaactcg
aaagaagatgaggagctacggcagagtctctggggactcatgatcaagacggaggaggaa
agtgagactgaaagtgagggaagtgtggatcctgaggagctggacagccgagcaggctcc
cctcagctggatgacatcagagttttccagaacgaggtcctgggaacgctgcagcggggc
agagaggagaacatctcctgtgaaaatctagtcctggagatcaactctctcaagcatgcc
tacaacattagcctaaaggaagtgatgcaggtcctgacccttgtagtcctggagttcccc
ctgcaacaagtcgatggcctgcttgacccaaaccgctactgtgccttgctgcttcctctg
ctcaaagcctggagccctgttttaaggaactacataaagcgtgcagctgaccacttggaa
gcattggcagccattgaggacttcttcttggaacatgaaactctcgttacttccatggcc
aaggtcctgatggctttctaccagctggagatcttggctgaggaaacaatcttgagctgg
ttcagccaaagagacacaactgacgaaggccagcagttacggaagaatcaacagctgcag
aggttcatccagtggctgagagaggcagaagaagagtcatccgaagatgactga

DBGET integrated database retrieval system