KEGG   Mus musculus (mouse): 22408
Entry
22408             CDS       T01002                                 

Gene name
Wnt1, Int, Int-1, Wnt-, Wnt-1, sw, swaying
Definition
(RefSeq) wingless-type MMTV integration site family, member 1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    22408 (Wnt1)
   04390 Hippo signaling pathway
    22408 (Wnt1)
   04150 mTOR signaling pathway
    22408 (Wnt1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    22408 (Wnt1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    22408 (Wnt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22408 (Wnt1)
   05205 Proteoglycans in cancer
    22408 (Wnt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    22408 (Wnt1)
   05226 Gastric cancer
    22408 (Wnt1)
   05217 Basal cell carcinoma
    22408 (Wnt1)
   05224 Breast cancer
    22408 (Wnt1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    22408 (Wnt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22408 (Wnt1)
   05022 Pathways of neurodegeneration - multiple diseases
    22408 (Wnt1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    22408 (Wnt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22408 (Wnt1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Morphogens
   22408 (Wnt1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 22408
NCBI-ProteinID: NP_067254
MGI: 98953
Ensembl: ENSMUSG00000022997
Vega: OTTMUSG00000020981
UniProt: P04426 Q3UR96
Position
15 F1; 15 54.65 cM
AA seq 370 aa
MGLWALLPSWVSTTLLLALTALPAALAANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgctgctgcccagctgggtttctactacgttgctactggcactgacc
gctctgcccgcagccctggctgccaacagtagtggccgatggtggggcatcgtgaacata
gcctcctccacgaacctgttgacggattccaagagtctgcagctggtgctcgagcccagt
ctgcagctgctgagccgcaagcagcggcgactgatccgacagaacccggggatcctgcac
agcgtgagtggagggctccagagcgctgtgcgagagtgcaaatggcaattccgaaaccgc
cgctggaactgccccactgctccggggccccacctcttcggcaagatcgtcaaccgaggc
tgccgagaaacagcgttcatcttcgcaatcacctccgccggggtcacacattccgtggcg
cgctcctgctccgaaggctccatcgagtcctgcacctgcgactaccggcggcgcggccct
gggggccccgactggcactgggggggctgcagtgacaacatcgattttggtcgcctcttt
ggccgagagttcgtggactccggggagaaggggcgggacctacgcttcctcatgaacctt
cacaacaacgaggcagggcgaacgaccgtgttctctgagatgcgccaagagtgcaaatgc
cacgggatgtccggctcctgcacggtgcgcacgtgttggatgcggctgcccacgctgcgc
gctgtgggcgacgtgctgcgcgaccgcttcgacggcgcctcccgcgtcctttacggcaac
cgaggcagcaaccgcgcctcgcgggcggagctgctgcgcctggagcccgaagaccccgcg
cacaagcctccctcccctcacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagtggccgcctgggcacagctggcacagctggacgagcttgcaacagctcgtctccc
gcgctggacggctgtgagctgctgtgctgtggccgaggccaccgcacgcgcacgcagcgc
gtcacggagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgttctgcacgagtgtctatga

KEGG   Mus musculus (mouse): 22417
Entry
22417             CDS       T01002                                 

Gene name
Wnt4, Wnt-, Wnt-4
Definition
(RefSeq) wingless-type MMTV integration site family, member 4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04919  Thyroid hormone signaling pathway
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    22417 (Wnt4)
   04390 Hippo signaling pathway
    22417 (Wnt4)
   04150 mTOR signaling pathway
    22417 (Wnt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    22417 (Wnt4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    22417 (Wnt4)
   04916 Melanogenesis
    22417 (Wnt4)
  09158 Development and regeneration
   04360 Axon guidance
    22417 (Wnt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22417 (Wnt4)
   05205 Proteoglycans in cancer
    22417 (Wnt4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    22417 (Wnt4)
   05226 Gastric cancer
    22417 (Wnt4)
   05217 Basal cell carcinoma
    22417 (Wnt4)
   05224 Breast cancer
    22417 (Wnt4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    22417 (Wnt4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22417 (Wnt4)
   05022 Pathways of neurodegeneration - multiple diseases
    22417 (Wnt4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    22417 (Wnt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22417 (Wnt4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Morphogens
   22417 (Wnt4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 22417
NCBI-ProteinID: NP_033549
MGI: 98957
Ensembl: ENSMUSG00000036856
Vega: OTTMUSG00000009828
UniProt: P22724 Q3ZB23
Position
4; 4 D3
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRLVEMHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagcccccgttcgtgcctgcggtccctgcgactcctcgtcttcgccgtgttctcggcc
gccgcgagcaattggctgtacctggccaagctgtcatcggtgggcagcatctccgaagag
gagacgtgcgagaaactcaaaggcctgatccagaggcaggtgcagatgtgcaaacggaac
cttgaggtgatggactcagtgcgccgtggtgcccagctggccatcgaggagtgccaatac
cagttccggaaccggcgctggaactgttccacactggactccctccctgtctttgggaag
gtggtgacacaagggacccgggaggcggcctttgtatacgccatctcttcagcaggtgtg
gcctttgcagtgacaagggcatgcagcagtggagaactggagaagtgtggctgtgaccgg
acagtgcacggggtcagcccacagggcttccagtggtcaggatgctcggacaacatcgcc
tatggcgtagccttctcacagtcctttgtggacgtccgggagaggagcaagggggcctcc
tccagccgggcactcatgaatcttcacaacaacgaggctggcaggaaggccatcttgaca
cacatgcgggtggagtgcaagtgtcacggggtgtcgggctcctgcgaggtaaagacgtgc
tggcgtgctgtaccgcccttccgccaggttggccacgcgctaaaggagaagtttgacggt
gccacggaggtggagccacgacgcgtaggctcctcccgggcgctggtgcctcggaatgca
cagttcaagccacatacagatgaggacctggtatacctggagcctagcccggacttctgt
gagcaggacatccgcagtggcgtgctaggcacgaggggccgcacgtgcaacaagacatct
aaagccattgacggctgcgagctactgtgctgtggccgcggcttccacacagcgcaagtg
gagctggccgagcgctgtggctgcaggttccactggtgctgcttcgtcaagtgccggcag
tgccagcggctcgtggagatgcacacgtgccggtga

DBGET integrated database retrieval system