KEGG   Mus musculus (mouse): 224088
Entry
224088            CDS       T01002                                 

Gene name
Atp13a3, AU022875, Gm1745, Gm541, Gm542
Definition
(RefSeq) ATPase type 13A3
  KO
K14951  cation-transporting P-type ATPase 13A3/4/5 [EC:7.2.2.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    224088 (Atp13a3)
SSDB
Motif
Pfam: P5-ATPase E1-E2_ATPase Hydrolase Cation_ATPase Cation_ATPase_N FapA
Other DBs
NCBI-GeneID: 224088
NCBI-ProteinID: NP_001121566
MGI: 2685387
Ensembl: ENSMUSG00000022533
Vega: OTTMUSG00000028859
UniProt: Q5XF89
Position
16; 16 B2
AA seq 1219 aa
MDKEERKTINKGQEDEMEIHGYNLCRWKLAMVFVGVICTGGFLLLLLYWLPEWRVKATCV
RAAVKDCEVVLLRTTDEFRVWFCAKIHFLPVENQPNLNAKCLVNEVSNGHAVHLTEENRC
EMNKYSQSQSQQMRYFTHHSIRYFWNDAIHNFDFLKGLDEGVSCASLYEKHSAGLTQGMH
AYRKLIYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSVDEYYYYALAIVIMSVV
SIISSLYSIRKQYVMLHDMVATHSTVRVSVCRENEEIEEIFSTDLVPGDVMIIPLNGTVM
PCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDVKGMGEEQYSPETHKRHTLFCGTT
VIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVVVAGIG
FIYTIINSILNEKEVQEIIIKSLDIITITVPPALPAAMTAGIVYAQRRLKKVGIFCISPQ
RINICGQLNLVCFDKTGTLTEDGLDLWGIQRVENTRFLLPEDNVCSEMLVKSQFVACMAT
CHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPSKQLLPEPTTA
GNQEMELFELPAIYEIGIVRQFPFSSALQRMSVVARTLGEKRMDAYMKGAPEVVASLCKP
ETVPVDFEKVLEDYTKQGFRVIALAHRKLESKLTWHKVQHISRDAIENNMDFMGLIIMQN
KLKQETPAVLEDLHKANIRTVMVTGDNMLTAVSVARDCGMILPQDKVIIAEALPPKDGKV
AKINWHYTDSLSQCSESSAIDSEAIPIKLAHDSLEDLEVTRYHFAMNGKSFSVILEHFQD
LVPKLMLHGTVFARMAPDQKTQLVEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELE
ASVASPFTSKTPSISCVPNLIREGRAALMTSFCVFKFMALYSIIQYFSVTLLYSILSNLG
DFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIVISVGFQSLG
FFWVKQYKVCDPNSDVCNTTRSACWNSSHLYNGTELDSCKIQNYENTTVFFISSFQYLTV
AVAFSKGKPFRQPCYKNYFFVISVIILYVFILFIMLHPVASVDQVLEIMCVPYQWRIYML
IIVLINAFVSITVEESVDRWGKCCLSWALSCRKKTPKAKYMYLAQELRFDPEWPPKPQTT
TEAKAVVKENGSCQIITIA
NT seq 3660 nt   +upstreamnt  +downstreamnt
atggacaaagaagaaaggaagactatcaacaagggtcaagaagatgaaatggagatacat
ggctataacttatgccgctggaagcttgccatggtttttgtaggagtgatttgtactggt
ggttttctcctcctcctcctctactggctgcctgagtggcgagtgaaagccacatgtgtt
agagctgcagttaaagactgtgaagtggtgcttctcaggacaactgatgaatttagagta
tggttttgtgcaaaaattcactttcttcctgtggagaatcaaccaaatttgaatgcaaaa
tgtttagttaatgaggtttctaatggccatgctgttcatctgactgaagaaaatagatgc
gagatgaataaatactcacagagtcagtcacaacagatgcgttattttacccaccatagc
ataagatatttctggaatgatgccattcacaattttgatttcttaaagggactggatgaa
ggtgtatcttgtgcatcactttatgaaaagcatagtgcaggactgacacaggggatgcat
gcctacagaaagttgatttatggagtaaatgaaattgctgtgaaagtgccttctgttttt
aagcttctaattaaagaggttctcaacccattttacattttccagctcttcagtgttatc
ctgtggagcgttgatgagtactattactatgctctagccattgtgatcatgtccgtagta
tccattataagttcactatattccattagaaagcaatatgttatgttacatgacatggtg
gcaactcacagtaccgtgagagtttcagtctgtagagaaaatgaagaaatagaagagatc
ttttctacagaccttgtgccgggagacgtcatgatcattccattaaatgggacagtcatg
ccttgtgatgcagtacttattaatggtacttgcattgtaaatgaaagcatgttaacagga
gaaagtgttccagtgacaaagactaatttgccaaatccttcagtggatgtgaaaggaatg
ggggaggagcagtacagcccagagacacacaagcggcacactttgttttgtgggacgact
gttattcagacccgtttctacactggagaacttgtgaaagccatagtagttagaacagga
tttagtacttccaaaggacagcttgttcgttctatactgtatcccaagccaactgacttt
aaactctatagagatgcctacttgtttctgctgtgtcttgtggtggtggctggaattgga
tttatctacacaatcatcaatagcatcctaaatgagaaagaagttcaagaaataattatt
aagtctcttgatatcattacaattactgtgccacctgctcttcctgctgcaatgactgct
gggattgtgtatgctcagagaagactgaaaaaagttgggattttctgtattagtccccag
aggataaacatctgtggacagctgaaccttgtttgctttgacaagactggaactcttacc
gaagatggtttagatctgtggggaattcagcgagtggaaaatacccgatttcttttacca
gaagacaatgtttgcagtgagatgttggtaaaatctcaatttgttgcttgtatggctact
tgtcattcacttacaaaaatcgaaggtgtactttctggtgacccacttgatttgaaaatg
tttgaagccattggatggattctggaagaagcaactgaagaagaaacagcacttcataac
cggatcatgcctactgtggttcgtccttccaaacaactgcttcctgaacctacaactgca
ggaaaccaagaaatggagctgtttgaacttccagctatttatgagataggaattgttcgc
cagtttccattttcttctgccttgcaacggatgagtgtggttgcaaggacactaggtgag
aagaggatggatgcctacatgaagggggcccctgaggttgtcgccagtctctgcaaaccg
gaaacagttccagttgattttgagaaagtgttagaagattataccaaacaaggtttccgt
gtaattgctcttgcacacagaaaattggagtcaaagctgacctggcataaagtacagcat
attagcagagatgccattgaaaacaacatggattttatgggattgattataatgcagaac
aaattgaagcaggaaacccctgcagtacttgaagatttgcataaagccaacattcgaact
gtcatggtcacaggagacaacatgttgacggctgtctctgtggccagagactgtgggatg
attctacctcaggataaagttattattgctgaagcattacctccaaaggatggaaaagtt
gccaagatcaattggcattatacagactccctgtcacagtgtagtgaatcatcagccatt
gactcagaggctattccaatcaaacttgcccatgatagtttagaggatcttgaggtgact
cgctatcattttgcgatgaatggaaagtcattttcggtgatactggaacattttcaagat
cttgttcctaagttgatgttgcatggtactgtgtttgctcgaatggcaccggatcagaag
acacaattggtggaggcattgcagaacgtagactactttgttgggatgtgcggtgatggt
gcaaatgattgtggtgctttgaagagggcacatggtggcatttccttatctgagcttgaa
gcttccgtggcatctccttttacttctaagacacccagtatctcctgtgtgccaaacctt
atcagggaaggtcgtgctgctttaatgacgtccttctgtgtgtttaaatttatggcgtta
tacagcatcatccagtacttcagtgttactctcctgtattctatcttgagtaacctggga
gactttcagtttctcttcattgatctggcaatcattttggtagtagtatttacaatgagt
ttaaatcctgcctggaaagagcttgtggcacagagaccaccttcaggccttatatctggg
gcgctcctcttctccgtcttgtctcagattgtgatctccgttggatttcagtcgctgggt
tttttctgggtcaagcagtataaagtgtgcgatccaaattcagatgtttgtaatacaaca
agaagcgcatgttggaactcgtcacacttatacaatgggactgaactcgattcgtgtaaa
atacaaaattatgaaaataccacagtattttttatctccagtttccagtacctcacagtg
gcggttgccttttcaaaaggaaaaccattcaggcagccttgctacaagaattattttttt
gttatatctgtgattattttgtatgttttcatattattcatcatgttgcatccagttgcc
tctgttgaccaggttcttgagattatgtgtgtaccataccagtggcgcatatatatgctt
atcattgttcttatcaatgccttcgtgtctatcacggtggaggagtcagtggatcggtgg
ggaaaatgctgtttgtcctgggccctgagctgtagaaagaaaactccaaaagcaaagtac
atgtacttagcacaggagctccgctttgatcctgagtggccgcctaaacctcagacaacg
acggaagccaaagctgtagtaaaggagaatggatcatgtcagattatcaccatagcataa

DBGET integrated database retrieval system