KEGG   Mus musculus (mouse): 224105
Entry
224105            CDS       T01002                                 

Gene name
Pak2, 5330420P17Rik, A130002K10Rik, AI836325, D16Ertd269, D16Ertd269e, PAK, PAK-2, mKIAA4182
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04660  T cell receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05170  Human immunodeficiency virus 1 infection
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    224105 (Pak2)
   04012 ErbB signaling pathway
    224105 (Pak2)
   04014 Ras signaling pathway
    224105 (Pak2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    224105 (Pak2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    224105 (Pak2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    224105 (Pak2)
  09158 Development and regeneration
   04360 Axon guidance
    224105 (Pak2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    224105 (Pak2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    224105 (Pak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    224105 (Pak2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     224105 (Pak2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   224105 (Pak2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 224105
NCBI-ProteinID: NP_796300
MGI: 1339984
Ensembl: ENSMUSG00000022781
Vega: OTTMUSG00000023944
UniProt: Q8CIN4 Q5DTJ2
Position
16 B2; 16 22.4 cM
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagagctagaagacaagcccccagcacctccagttcggatgagcagt
accatttttagcaccggaggaaaagatcctttatcagccaatcacagtttgaaacctttg
ccttctgttccagaggaaaaaaaacccaggaacaaaatcatctccatattctctggcaca
gaaaaaggaagtaaaaagaaagaaaaagaacggccagagatttctcccccatctgatttt
gagcacaccatccatgttggctttgatgctgttacgggagagttcactggcatgccagaa
cagtgggcgcggctgttgcagacctccaacattaccaaactcgagcagaagaagaaccct
caggcagtgctggatgtcttgaagttctacgactccaacactgtgaaacagaagtacctg
agtttcactcctcctgagaaagatggcttcccttctggaacaccagcactgaacaccaag
gggtcagagacatcagctgtagtgacagaggaagatgatgatgatgaagacgctgctcct
cccgtcattgcccctcggccagatcatacaaaatcaatttacacacggtctgtcatcgac
cccattcctgctccagttggtgattctaatgttgacagtggtgccaagtcttcagacaaa
cagaaaaagaaagccaagatgaccgatgaagagattatggagaaattaagaactattgtg
agcataggggacccaaagaaaaaatacacaagatatgaaaaaattgggcaaggggcttct
ggaacagtttttactgccactgatgtggccctggggcaagaggttgctatcaagcagatt
aatttacagaaacaaccaaagaaggaattgatcattaatgaaattctggtgatgaaagag
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagatgagttgttt
gtggtaatggagtacctcgctggtgggtccctcactgatgttgtaacagaaacctgcatg
gacgaagcgcagattgccgccgtgtgcagagagtgtttacaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtgcttttgggaatggaaggc
tcagttaaacttactgacttcggcttctgtgcccagatcactcctgaacagagcaaacgc
agtactatggttggaacaccgtactggatggcaccagaggtggtgacacggaaagcctat
ggtcccaaagttgacatatggtctctgggcatcatggctatcgagatggttgaaggagag
cctccatacctcaacgaaaatcctctgcgggcattatacctgatagctacaaatggaact
cctgaacttcagaatccagaaaaactttccccaatatttcgggatttcttaaatcggtgt
ttggaaatggatgtggagaaaaggggttcggccaaggaactgttacagcatcctttcctg
aaactggccaaaccattgtctagcttgacgccactgatcctggcagctaaagaagcaatg
aagagtaaccgctaa

DBGET integrated database retrieval system