KEGG   Mus musculus (mouse): 22412
Entry
22412             CDS       T01002                                 

Gene name
Wnt9b, Wnt1, Wnt14, Wnt14b, Wnt15, cl, clf, clf1, wnt-14b, wnt-15
Definition
(RefSeq) wingless-type MMTV integration site family, member 9B
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    22412 (Wnt9b)
   04390 Hippo signaling pathway
    22412 (Wnt9b)
   04150 mTOR signaling pathway
    22412 (Wnt9b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    22412 (Wnt9b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    22412 (Wnt9b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22412 (Wnt9b)
   05205 Proteoglycans in cancer
    22412 (Wnt9b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    22412 (Wnt9b)
   05226 Gastric cancer
    22412 (Wnt9b)
   05217 Basal cell carcinoma
    22412 (Wnt9b)
   05224 Breast cancer
    22412 (Wnt9b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    22412 (Wnt9b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22412 (Wnt9b)
   05022 Pathways of neurodegeneration - multiple diseases
    22412 (Wnt9b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    22412 (Wnt9b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22412 (Wnt9b)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Morphogens
   22412 (Wnt9b)
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 22412
NCBI-ProteinID: NP_035849
MGI: 1197020
Ensembl: ENSMUSG00000018486
Vega: OTTMUSG00000003017
UniProt: O35468 Q2TBA6 Q8C718
Position
11 E1; 11 67.47 cM
AA seq 359 aa
MRPAPALALAALCLLVLPAAAAAAAYFGLTGREVLTPFPGLGTAAAPAQAGAHLKQCDLL
KLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETAF
LYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLG
PKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVL
KLRYDTAVKVSSATNEALGRLELWAPAKPGGPAKGLAPRPGDLVYMEDSPSFCRPSKYSP
GTAGRVCSRDSSCSSLCCGRGYDTQSRMVVFSCHCQVQWCCYVECQQCAQQELVYTCKR
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcgccccgcgcccgcgctggccctggctgcgctctgcctgctggtgctgcctgccgct
gccgccgccgccgcctacttcggcctgaccggtcgtgaggtcctgacacccttcccaggc
ctgggtacggcagcagccccggcacaggctggtgctcacctgaagcagtgtgacctactg
aagctgtccaggcggcagaagcagctctgcaggcgggagcccggcctggctgagaccctg
agggatgctgcacacctggggctgctggaatgtcagttccagttcaggcaggagcgctgg
aactgcagcctggaggggaggactggcctgctccagagaggctttaaggagacggccttc
ctgtatgcagtgtctgcagctgccctcacgcatgcactggccagggcctgcagtgctggg
cgcatggagcgctgtacttgtgacgactccccaggcctggagagccggcaggcctggcag
tggggtgtgtgtggtgacaatctgaagtacagcaccaagttcctcagcaacttcctgggg
cccaagagaggaagcaaggacctgagggcgagggctgacgcccacaacacccacgtgggc
atcaaggctgtgaagagcggcctgagaacaacctgcaagtgccatggtgtgtcaggctcc
tgtgctgttcgtacctgttggaagcagctctccccgtttcgcgagaccggccaggtgctg
aagctacgctatgacacggctgtcaaggtgtccagtgccaccaacgaggccttgggtcgt
ctggagctatgggcccccgctaagccaggtggtcccgccaagggcctagcccctcgtccc
ggggacctggtctacatggaagattctcccagcttctgccggcccagcaagtactctccg
ggcacggcaggcagggtgtgttctcgagactccagttgcagcagcctatgctgtgggcga
ggctacgacacccagagccgcatggtggttttctcctgccactgtcaggtgcagtggtgc
tgctacgtggagtgccagcagtgtgcacagcaggagctcgtgtatacctgcaagcgctag

DBGET integrated database retrieval system