KEGG   Mus musculus (mouse): 224129
Entry
224129            CDS       T01002                                 

Gene name
Adcy5, AC, AW121902, Ac5
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01522  Endocrine resistance
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
mmu05012  Parkinson disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05032  Morphine addiction
mmu05034  Alcoholism
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05207  Chemical carcinogenesis - receptor activation
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    224129 (Adcy5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    224129 (Adcy5)
   04371 Apelin signaling pathway
    224129 (Adcy5)
   04072 Phospholipase D signaling pathway
    224129 (Adcy5)
   04024 cAMP signaling pathway
    224129 (Adcy5)
   04022 cGMP-PKG signaling pathway
    224129 (Adcy5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    224129 (Adcy5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    224129 (Adcy5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    224129 (Adcy5)
   04062 Chemokine signaling pathway
    224129 (Adcy5)
  09152 Endocrine system
   04911 Insulin secretion
    224129 (Adcy5)
   04923 Regulation of lipolysis in adipocytes
    224129 (Adcy5)
   04912 GnRH signaling pathway
    224129 (Adcy5)
   04913 Ovarian steroidogenesis
    224129 (Adcy5)
   04915 Estrogen signaling pathway
    224129 (Adcy5)
   04914 Progesterone-mediated oocyte maturation
    224129 (Adcy5)
   04921 Oxytocin signaling pathway
    224129 (Adcy5)
   04926 Relaxin signaling pathway
    224129 (Adcy5)
   04935 Growth hormone synthesis, secretion and action
    224129 (Adcy5)
   04918 Thyroid hormone synthesis
    224129 (Adcy5)
   04928 Parathyroid hormone synthesis, secretion and action
    224129 (Adcy5)
   04916 Melanogenesis
    224129 (Adcy5)
   04924 Renin secretion
    224129 (Adcy5)
   04925 Aldosterone synthesis and secretion
    224129 (Adcy5)
   04927 Cortisol synthesis and secretion
    224129 (Adcy5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    224129 (Adcy5)
   04270 Vascular smooth muscle contraction
    224129 (Adcy5)
  09154 Digestive system
   04970 Salivary secretion
    224129 (Adcy5)
   04971 Gastric acid secretion
    224129 (Adcy5)
   04972 Pancreatic secretion
    224129 (Adcy5)
   04976 Bile secretion
    224129 (Adcy5)
  09156 Nervous system
   04724 Glutamatergic synapse
    224129 (Adcy5)
   04727 GABAergic synapse
    224129 (Adcy5)
   04725 Cholinergic synapse
    224129 (Adcy5)
   04728 Dopaminergic synapse
    224129 (Adcy5)
   04726 Serotonergic synapse
    224129 (Adcy5)
   04723 Retrograde endocannabinoid signaling
    224129 (Adcy5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    224129 (Adcy5)
  09149 Aging
   04211 Longevity regulating pathway
    224129 (Adcy5)
   04213 Longevity regulating pathway - multiple species
    224129 (Adcy5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    224129 (Adcy5)
   04714 Thermogenesis
    224129 (Adcy5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    224129 (Adcy5)
   05207 Chemical carcinogenesis - receptor activation
    224129 (Adcy5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    224129 (Adcy5)
   05163 Human cytomegalovirus infection
    224129 (Adcy5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    224129 (Adcy5)
  09165 Substance dependence
   05030 Cocaine addiction
    224129 (Adcy5)
   05031 Amphetamine addiction
    224129 (Adcy5)
   05032 Morphine addiction
    224129 (Adcy5)
   05034 Alcoholism
    224129 (Adcy5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    224129 (Adcy5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    224129 (Adcy5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    224129 (Adcy5)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     224129 (Adcy5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 224129
NCBI-ProteinID: NP_001012783
MGI: 99673
Ensembl: ENSMUSG00000022840
UniProt: P84309
Position
16; 16 B3
AA seq 1262 aa
MSGSKSVSPPGYAAQTAASPAPRGGPEHRAAWGEADSRANGYPHAPGGSTRGSTKRSGGA
VTPQQQQRLASRWRGGDDDEDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDGGRGSRRQR
RGAAGGGSTRAPPAGGSGSSAAAAAAAGGTEVRPRSVELGLEERRGKGRAAEELEPGTGI
VEDGDGSEDGGSSVASGSGTGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQ
SSLTMLMAVLVLVCLVMLAFHAARPPLQIAYLAVLAAAVGVILIMAVLCNRAAFHQDHMG
LACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSA
LHLAISLHTNSQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARL
HSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFT
SLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVE
MGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG
KAGRIHITKATLNYLNGDYEVEPGCGGDRNAYLKEHSIETFLILSCTQKRKEEKAMIAKM
NRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEF
LGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQ
ITIVPHSLFMLSFYLSCFLLLALVVFVSVIYACVKLFPTPLQTLSRKIVRSKKNSTLVGV
FTITLVFLSAFVNMFMCNSKNLVGCLAEEHNITVNQVNACHVMESAFNYSLGDEQGFCGS
PQPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIEFIYVLIVEVPGVTLFDNAD
LLVTANAIDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWK
LQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
FSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDST
YDKAGKTHIKAIADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIW
GNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPP
LS
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgctgcacagacagcggcgtcgcca
gcgccccggggaggcccggagcatcgcgccgcttggggagaagccgattcccgcgccaat
ggctacccccacgcccccgggggatcaacccgcggctccaccaagagatctgggggagcg
gtgaccccacaacagcagcagcgcctggccagccgttggcgcggtggcgatgacgacgaa
gaccctccactaagcggtgatgaccctctggctgggggcttcggcttcagcttccgctct
aagtccgcctggcaggagcgcggtggcgacgacggcggtcgcggcagcaggcggcagcgg
cggggcgcggctggagggggcagcacccgggcgccccctgcgggcggcagcggcagttcg
gcggcggccgcagcggccgcaggtggcacagaggtgcgcccccgctcggtggagctgggc
ctggaggagcgtcgaggaaaaggccgagcggccgaggagctggagcccgggactggcatc
gtcgaggatggagacgggtcggaggatggaggcagttctgtggcgtcaggctctgggacc
ggcgcggtgctgtcgttgggcgcctgctgcctggccttgctgcagatattccgctctaag
aagttcccgtcggacaaactggagcgtctgtaccagcgctacttcttccgcctgaaccag
agcagtctcaccatgctcatggccgtgctggtgcttgtgtgcctggtcatgctggctttc
cacgcggcgcgccccccgctccagatagcctacctggccgtgttggcagctgctgtgggc
gtgatccttatcatggccgtgctctgcaaccgtgcagcgttccaccaggaccacatgggc
ctggcctgctatgcgctcattgcagtggtgctggccgtccaggtagtgggcctgttgctg
ccacagccacgcagcgcctccgagggcatctggtggaccgtgttcttcatctataccatc
tacaccctgctgcctgtgcgcatgagggctgcggtgctcagcggggtgcttctgtcggct
ctccacttggccatctctctgcacaccaactcccaggaccagtttctgctgaaacagctt
gtctccaatgtcctcatcttctcctgcaccaacattgtgggtgtgtgcactcactaccca
gctgaggtctcccagagacaggccttccaggagacccgggagtgtatccaggctcggctc
cattcccagcgggagaaccagcaacaggagcgtctcctgctgtctgtccttccccgtcat
gttgccatggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccacaag
atctacatccagaagcatgacaatgtgagcatcctgtttgctgacatcgagggcttcacc
agcctggcttcccagtgtactgcccaagaactggtcatgaccctcaatgagctcttcgcc
cgctttgacaagttggctgcggagaatcactgtttacggattaagatcctcggggattgt
tactactgcgtctcggggctgcctgaagccagagccgaccatgcccactgctgcgtggag
atgggaatggacatgatcgaggccatctcgttggtccgggaggtgacaggggtgaacgtg
aacatgcgcgtgggaattcacagcgggagagtacactgcggtgtccttggtctcagaaag
tggcaattcgacgtgtggtctaacgatgtcactctggccaaccacatggaagctggtggc
aaggcgggccgcatccacatcaccaaggccacactcaactacctgaatggggactatgag
gtggaaccaggctgtggtggcgatcgcaatgcctacctcaaggagcacagcattgagacc
ttcctcatcctgagctgtacccagaagcggaaagaagagaaggccatgatcgccaagatg
aaccgccagagaaccaactccatcggacacaatccgcctcactggggagccgagcgcccc
ttctacaaccacttgggcggcaaccaggtgtcaaaggagatgaagaggatgggctttgag
gaccccaaggacaagaatgcccaggaaagtgcgaacccagaggatgaagtggacgagttt
ctgggtcgggccatcgatgccaggagcatcgacagactgcgatctgaacacgtccgcaag
ttcctcctgaccttcagggagcccgacttagagaagaagtactccaagcaggtggatgac
cgatttggtgcctatgtggcctgcgcctcgcttgttttcctcttcatctgctttgtccag
atcaccattgtgccccactccctgttcatgctgagtttctacctgtcgtgtttcctgctg
ctggccttggtggtgtttgtgtctgtgatctatgcctgtgtgaagcttttccccactccc
ctgcagacactctccaggaagatagtgcgatccaagaagaacagcaccctggtcggggta
ttcaccatcaccctggtgttcctctcggcttttgtcaacatgttcatgtgcaactctaag
aacctggtgggctgcctggcagaggagcacaacatcacggtgaaccaggtcaacgcatgt
catgtgatggagtcggccttcaactacagcctgggcgacgagcagggcttctgtggcagc
ccccagcccaactgcaacttcccagagtacttcacctacagcgtgctgctcagcctgctg
gcctgctccgtgttcctgcagatcagctgcattggaaagctggtgctcatgctggccatt
gagttcatctatgtgctcatcgtggaggtgcccggcgtcacactcttcgacaacgctgac
cttctggtcaccgccaatgccatagacttcagcaacaacgggacctcccagtgccctgag
catgcaaccaaggtggcgctgaaggtggtgacgcccatcatcatctctgtcttcgtgctg
gctctgtatctgcatgcccagcaggtggagtccactgctcgccttgacttcctctggaaa
ctgcaggccacagaagagaaggaggagatggaggagctgcaggcctacaatcggcgcctg
ctgcacaacattctgcccaaggacgtggctgcccacttcctggcccgggaacggcgcaat
gacgagctgtactaccaatcgtgcgagtgtgtggctgtcatgtttgcctccattgccaac
ttctccgaattctatgtagagctagaggccaacaatgagggcgtcgagtgcctacggctg
ctcaatgagatcatcgcagacttcgatgagatcatcagtgaggatcggttcaggcagctg
gaaaagatcaagaccataggcagcacctacatggctgcctctggcctcaacgactccacc
tatgacaaggcaggcaagacccacatcaaggctattgcagacttcgctatgaagctgatg
gaccaaatgaagtacatcaatgagcactccttcaacaacttccagatgaagattgggctc
aacattggacctgtagtggctggagtcattggggctcgcaagcctcagtatgacatctgg
ggcaatacagtgaatgtggccagccgtatggacagcactggggtgcctgaccgcatccag
gttactacagatatgtaccaggtgctggccgccaacacataccagctggagtgccggggt
gtggtcaaggtcaagggcaagggtgagatgatgacttacttcctcaatggagggcctccc
ctcagttag

DBGET integrated database retrieval system