KEGG   Mus musculus (house mouse): 22419
Entry
22419             CDS       T01002                                 
Symbol
Wnt5b, AW545702, Wnt-5b
Name
(RefSeq) wingless-type MMTV integration site family, member 5B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    22419 (Wnt5b)
   04390 Hippo signaling pathway
    22419 (Wnt5b)
   04150 mTOR signaling pathway
    22419 (Wnt5b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    22419 (Wnt5b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    22419 (Wnt5b)
  09158 Development and regeneration
   04360 Axon guidance
    22419 (Wnt5b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22419 (Wnt5b)
   05205 Proteoglycans in cancer
    22419 (Wnt5b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    22419 (Wnt5b)
   05226 Gastric cancer
    22419 (Wnt5b)
   05217 Basal cell carcinoma
    22419 (Wnt5b)
   05224 Breast cancer
    22419 (Wnt5b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    22419 (Wnt5b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22419 (Wnt5b)
   05022 Pathways of neurodegeneration - multiple diseases
    22419 (Wnt5b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    22419 (Wnt5b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22419 (Wnt5b)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Morphogens
   22419 (Wnt5b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 22419
NCBI-ProteinID: NP_001258686
MGI: 98959
Ensembl: ENSMUSG00000030170
UniProt: P22726
Position
6:complement(119409492..119521880)
AA seq 359 aa
MPSLLLVVVAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAV
SAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRITRQGKLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQYVCK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcccagcctgctgctggtggtcgtggcagctctgctctccagctgggcacagctgctg
actgacgccaactcctggtggtcactagctctgaacccagtgcagagaccggagatgttc
atcattggcgctcagcccgtgtgcagccaacttcctgggctttccccaggccagagaaag
ctgtgtcagttgtatcaggagcacatgtcctacatcggggagggagccaagacgggcatc
agagagtgccaacaccagtttcgacagaggcgctggaactgcagcaccgtggacaacaca
tctgtctttggcagagttatgcagataggtagccgagagactgccttcacgtatgcagtg
agcgccgctggcgtggtgaatgccatcagccgagcctgcagagagggtgagctgtccacc
tgtggctgcagccgtgctgcgaggcccaaggacctgcctcgggactggctgtggggtggc
tgtggagacaacgtggagtacggctaccgctttgccaaggagtttgtggatgcccgagag
cgtgagaagaactttgccaagggatcggaggagcagggccgagctctcatgaacctacag
aacaacgaggctggccgccgggccgtgtataagatggctgatgtcgcctgcaaatgtcac
ggagtctccgggtcctgcagcctcaagacctgctggctccagctggccgagttccgcaag
gtgggggaccgtttgaaggagaagtacgacagcgccgcggccatgcgcatcacccgccag
ggcaagctggagctggccaacagccgcttcaaccagcccaccccagaggacctggtctac
gtggaccccagtcctgactactgcctgcgtaatgagaccacaggctccctgggcacccag
ggtcgcctctgcaacaagacctcagagggcatggacggctgcgagctcatgtgctgtggc
cgcggctatgaccgcttcaagagcgttcaggtggaacgctgccactgcaggttccactgg
tgttgctttgtcagatgcaaaaaatgcaccgaggttgtggaccagtatgtctgtaagtga

DBGET integrated database retrieval system