KEGG   Mus musculus (mouse): 22427
Entry
22427             CDS       T01002                                 

Gene name
Wrn, AI846146
Definition
(RefSeq) Werner syndrome RecQ like helicase
  KO
K10900  werner syndrome ATP-dependent helicase [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    22427 (Wrn)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22427 (Wrn)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     22427 (Wrn)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    22427 (Wrn)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     22427 (Wrn)
Motif
Pfam: DNA_pol_A_exo1 Helicase_C DEAD RQC HRDC HTH_40 RecQ_Zn_bind ResIII
Other DBs
NCBI-GeneID: 22427
NCBI-ProteinID: NP_001116294
MGI: 109635
Ensembl: ENSMUSG00000031583
Vega: OTTMUSG00000060957
UniProt: O09053 Q3TB25 Q8BWH5
Structure
PDB: 
2E6M 2E6L

Position
8 A3; 8 20.3 cM
AA seq 1401 aa
METTSLQRKFPEWMSMQSQRCATEEKACVQKSVLEDNLPFLEFPGSIVYSYEASDCSFLS
EDISMRLSDGDVVGFDMEWPPIYKPGKRSRVAVIQLCVSESKCYLFHISSMSVFPQGLKM
LLENKSIKKAGVGIEGDQWKLLRDFDVKLESFVELTDVANEKLKCAETWSLNGLVKHVLG
KQLLKDKSIRCSNWSNFPLTEDQKLYAATDAYAGLIIYQKLGNLGDTAQVFALNKAEENL
PLEMKKQLNSISEEMRDLANRFPVTCRNLETLQRVPVILKSISENLCSLRKVICGPTNTE
TRLKPGSSFNLLSSEDSAAAGEKEKQIGKHSTFAKIKEEPWDPELDSLVKQEEVDVFRNQ
VKQEKGESENEIEDNLLREDMERTCVIPSISENELQDLEQQAKEEKYNDVSHQLSEHLSP
NDDENDSSYIIESDEDLEMEMLKSLENLNSDVVEPTHSTWLEMGTNGRLPPEEEDGHGNE
AIKEEQEEEDHLLPEPNAKQINCLKTYFGHSSFKPVQWKVIHSVLEERRDNVVVMATGYG
KSLCFQYPPVYTGKIGIVISPLISLMEDQVLQLELSNVPACLLGSAQSKNILGDVKLGKY
RVIYITPEFCSGNLDLLQQLDSSIGITLIAVDEAHCISEWGHDFRSSFRMLGSLKTALPL
VPVIALSATASSSIREDIISCLNLKDPQITCTGFDRPNLYLEVGRKTGNILQDLKPFLVR
KASSAWEFEGPTIIYCPSRKMTEQVTAELGKLNLACRTYHAGMKISERKDVHHRFLRDEI
QCVVATVAFGMGINKADIRKVIHYGAPKEMESYYQEIGRAGRDGLQSSCHLLWAPADFNT
SRNLLIEIHDEKFRLYKLKMMVKMEKYLHSSQCRRRIILSHFEDKCLQKASLDIMGTEKC
CDNCRPRLNHCLTANNSEDASQDFGPQAFQLLSAVDILQEKFGIGIPILFLRGSNSQRLP
DKYRGHRLFGAGKEQAESWWKTLSHHLIAEGFLVEVPKENKYIKTCSLTKKGRKWLGEAS
SQSPPSLLLQANEEMFPRKVLLPSSNPVSPETTQHSSNQNPAGLTTKQSNLERTHSYKVP
EKVSSGTNIPKKSAVMPSPGTSSSPLEPAISAQELDARTGLYARLVEARQKHANKMDVPP
AILATNKVLLDMAKMRPTTVENMKQIDGVSEGKAALLAPLLEVIKHFCQVTSVQTDLLSS
AKPHKEQEKSQEMEKKDCSLPQSVAVTYTLFQEKKMPLHSIAENRLLPLTAAGMHLAQAV
KAGYPLDMERAGLTPETWKIIMDVIRNPPINSDMYKVKLIRMLVPENLDTYLIHMAIEIL
QSGSDSRTQPPCDSSRKRRFPSSAESCESCKESKEAVTETKASSSESKRKLPEWFAKGNV
PSADTGSSSSMAKTKKKGLFS
NT seq 4206 nt   +upstreamnt  +downstreamnt
atggaaaccacttcactacagcggaaatttccagaatggatgtctatgcagagtcaaaga
tgtgctacagaagaaaaggcctgcgttcagaagagtgttcttgaagataacctcccattc
ttagaattccctggatccattgtttacagttatgaagctagtgattgctccttcctgtct
gaagacattagcatgcgtctgtctgatggcgatgtggtgggatttgacatggaatggccg
cccatatacaagccagggaaaagaagcagagtcgcagtgatccagttgtgtgtgtctgag
agcaaatgttacttgtttcacatttcttccatgtcagttttcccccagggattaaaaatg
ttactagaaaacaaatcaattaagaaggcaggggttgggattgaaggggaccagtggaaa
cttctgcgtgattttgacgtcaagttggagagttttgtggagctgacggatgttgccaat
gaaaagttgaagtgcgcagagacctggagcctcaatggtctggttaaacacgtcttaggg
aaacaacttttgaaagacaagtccatccgctgcagcaattggagtaatttccccctcact
gaggaccagaaactgtatgcagccactgatgcttatgctggtcttatcatctatcaaaaa
ttaggaaatttgggtgatactgcgcaagtgtttgctctaaataaagcagaggaaaaccta
cctctggagatgaagaaacagttgaattcaatctccgaagaaatgagggacctagccaat
cgttttcctgtcacttgcagaaatttggaaactctccagagggttcctgtaatattgaag
agtatttcagaaaatctctgttcattgagaaaagtgatctgtggtcctacaaacactgag
actagactgaagccgggcagtagttttaatttactgtcatcagaggattcagctgctgct
ggagaaaaagagaaacagattggaaaacatagtacttttgctaaaattaaagaagaacca
tgggacccagaacttgacagtttagtgaagcaagaggaggttgatgtatttagaaatcaa
gtgaagcaagaaaaaggtgaatctgaaaatgaaatagaagacaatctgttgagagaagat
atggaaagaacttgtgtgattcctagtatttcagaaaatgaactccaagatttggaacag
caagctaaagaagaaaaatataatgatgtttctcaccaactttctgagcatttatctccc
aatgatgatgagaatgactcctcctatataattgaaagtgatgaagatttggaaatggag
atgctgaagtctttagaaaacctaaatagtgacgtggtggaacccactcactctacatgg
ttggaaatgggaaccaatgggcgtcttcctcctgaggaggaagatggacacggaaatgaa
gccatcaaagaggagcaggaagaagaggaccatttattgccggaacccaacgcaaagcaa
attaattgcctcaagacctatttcggacacagcagttttaaaccggttcagtggaaagtc
atccattctgtattagaagagagaagagataatgttgttgtcatggcaactggatatggg
aagagtctgtgcttccagtatccgcctgtttatacaggcaagattggcattgtcatttca
cctctcatttccttaatggaagaccaagtcctccagcttgagctgtccaatgttccagcc
tgtttacttggatctgcacagtcaaaaaatattctaggagatgttaaattaggcaaatat
agggtcatctacataactccagagttctgttctggtaacttggatctactccagcaactt
gactctagtattggcatcactctcattgctgtggatgaggctcactgcatttcagagtgg
ggccatgatttcagaagttcattcaggatgctgggctctcttaaaacagcgctcccattg
gttccagtcattgcactctccgctactgcaagctcttccatccgggaagacattataagc
tgcttaaacctgaaagaccctcagatcacctgcactggatttgatcggccaaatctgtac
ttagaagttggacggaaaacagggaacatccttcaggatctaaagccgtttctcgtccga
aaggcaagttctgcctgggaatttgaaggtccaaccatcatctattgtccttcgagaaaa
atgacagaacaagttactgctgaacttgggaaactgaacttagcctgcagaacataccac
gctggcatgaaaattagcgaaaggaaggacgttcatcataggttcctgagagatgaaatt
cagtgtgttgtagctactgtagcttttggaatgggcattaataaagctgacattcgcaaa
gttattcattatggtgcgcctaaggaaatggaatcctattaccaggaaattggtagagct
ggccgggatggacttcagagttcctgtcacttgctctgggctccagcagactttaacaca
tccaggaatctccttattgagattcacgatgaaaagttccggttatataaattaaagatg
atggtaaagatggaaaaataccttcactccagtcagtgtaggcgacgaatcatcttgtcc
cattttgaggacaaatgtctgcagaaggcctccttggacattatgggaactgaaaaatgc
tgtgataattgcaggcccaggctgaatcattgccttactgctaacaactcagaggacgca
tcccaagactttgggccacaagcattccagctactgtctgctgtggacatcctgcaggag
aaatttggaattgggattccgatcttatttctccgaggatctaattctcagcgtcttcct
gataaatatcggggtcacaggctctttggtgctggaaaggagcaagcagaaagttggtgg
aagaccctttctcaccatctcatagctgaaggattcttggtagaagttcccaaggaaaac
aaatatataaagacatgttccctcacaaaaaagggtagaaagtggcttggagaagccagt
tcgcagtctcctccgagccttctccttcaagctaatgaagagatgtttccaaggaaagtt
ctgctaccaagttctaatcctgtatctccagaaacgacgcaacattcctctaatcaaaac
ccagctggattaactaccaagcagtctaatttggagagaacgcattcttacaaagtgcct
gagaaagtttcttctgggactaacattcctaaaaaaagtgccgtgatgccgtcaccagga
acatcttccagccccttagaacctgccatctcagcccaagagctggacgctcggactggg
ctatatgccaggctggtggaagcaaggcagaaacacgctaataagatggatgtacctcca
gctattttagcaacaaacaaggttctgctggacatggctaaaatgagaccgactactgtt
gaaaacatgaaacagatcgacggtgtctctgaaggcaaagctgctctgttggcccctctg
ttggaagtcatcaaacatttctgtcaagtaactagtgttcagacagacctcctttccagt
gccaaacctcacaaggaacaggagaaaagtcaggagatggaaaagaaagactgctcactc
ccccagtctgtggccgtcacatacactctattccaggaaaagaaaatgcccttacacagc
atagctgagaacaggctcctgcctctcacagcagccggcatgcacttagcccaggcggtg
aaagccggctaccccctggatatggagcgagctggcctgaccccagagacttggaagatt
attatggatgtcatccgaaaccctcccatcaactcagatatgtataaagttaaactcatc
agaatgttagttcctgaaaacttagacacgtacctcatccacatggcgattgagattctt
cagagtggttccgacagcagaacccagcctccttgtgattccagcaggaagaggcgtttc
cccagctctgcagagagttgtgagagctgtaaggagagcaaagaggcggtcaccgagacc
aaggcatcatcttcagagtcaaagagaaaattacccgagtggtttgccaaaggaaatgtg
ccctcagctgataccggcagctcatcatcaatggccaagaccaaaaagaaaggtctcttt
agttaa

DBGET integrated database retrieval system