KEGG   Mus musculus (mouse): 22431
Entry
22431             CDS       T01002                                 

Gene name
Wt1, D630046I19Rik, Wt-1
Definition
(RefSeq) Wilms tumor 1 homolog
  KO
K09234  Wilms tumor protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    22431 (Wt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22431 (Wt1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    22431 (Wt1)
SSDB
Motif
Pfam: WT1 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-met zf-C2H2_aberr
Other DBs
NCBI-GeneID: 22431
NCBI-ProteinID: NP_659032
MGI: 98968
Ensembl: ENSMUSG00000016458
Vega: OTTMUSG00000014987
UniProt: Q199A7
Position
2 E2-E3; 2 55.06 cM
AA seq 517 aa
MDFLLSQEPASTCVPEPASQHTLRREPGCVQQPEQPGDRGPRSAWAKSSAENPQDRRSGE
PSASEPHLMGSDVRDLNALLPAVSSLGGGGGGCGLPVSGAAQWAPVLDFAPPGASAYGSL
GGPAPPPAPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTLHFSGQFTGTAGACRYGPF
GPPPPSQASSGQARMFPNAPYLPSCLESQPTIRNQGYSTVTFDGAPSYGHTPSHHAAQFP
NHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQ
LECMTWNQMNLGATLKGMAAGSSSSVKWTEGQSNHGTGYESENHTAPILCGAQYRIHTHG
VFRGIQDVRRVSGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP
YQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEK
PFSCRWHSCQKKFARSDELVRHHNMHQRNMTKLQLAL
NT seq 1554 nt   +upstreamnt  +downstreamnt
ctggacttcctcctgtcgcaggagccggcttccacgtgtgtcccggagccggcgtctcag
cacacgctccgccgggagcccgggtgcgtccagcagccggagcaacctggggaccgaggc
ccccggagcgcctgggccaagtccagcgccgagaatccgcaggatcgcaggagcggagaa
ccgtccgcatccgagccgcacctcatgggttccgacgtgcgggacctgaacgcgctgctg
cccgctgtgtcttcgctgggcggcggcggcggcggctgcgggctccctgtgagcggcgca
gcgcagtgggcgcccgtgttggacttcgcgcctccgggcgcctcggcttacgggtcgctg
ggcggtcccgcgcctcctcccgctccgccgccgcctccgccgccaccccactccttcatc
aaacaggagcccagctggggcggcgccgagccacacgaggagcagtgcctgagcgccttc
accttgcacttctcgggccagttcaccggtacagccggggcctgtcgctacggacccttc
ggtcctcccccgcccagccaggcgtcctcgggccaggccaggatgttccccaatgcgccc
tacctgcccagctgcctggagagccagcctaccatccgcaaccaaggatacagcacggtc
actttcgacggggcgcccagctatggccacacgccctcgcatcacgcggcgcagttcccc
aaccattccttcaaacacgaggaccccatgggccagcagggctcgctgggcgagcagcag
tactccgtgccacctccggtgtatggctgccacacccctactgacagttgcacaggcagc
caggccctgctcctgaggacgccctacagcagtgacaatttataccaaatgacctcccag
cttgaatgcatgacctggaatcagatgaacctaggagctaccttaaagggaatggctgct
gggagctccagctcagtgaaatggacagaagggcagagcaaccacggcacagggtatgag
agtgagaaccacacggcccccatcctctgtggtgcccagtacagaatacacacccacggg
gtcttccgaggcattcaggatgtgcggcgtgtatctggagtggccccaactcttgtccgg
tcagcatctgaaaccagtgagaaacgtcctttcatgtgtgcatacccaggctgcaataag
agatattttaagctgtcccacttacagatgcatagccggaagcacactggtgagaaacca
taccagtgtgacttcaaggactgcgagagaaggttttctcgctcagaccagctcaaaaga
caccaaaggagacacacaggtgtgaaaccattccagtgtaaaacttgtcagcgaaagttt
tcccggtccgaccatctgaagacccacaccaggactcatacaggtaaaacaagtgaaaag
cccttcagctgtcggtggcacagttgtcagaaaaagtttgcgcgctcagacgaattggtc
cgccatcacaacatgcatcagagaaacatgaccaaactccagctggcgctttga

DBGET integrated database retrieval system