KEGG   Mus musculus (mouse): 22433
Entry
22433             CDS       T01002                                 

Gene name
Xbp1, D11Ertd39, D11Ertd39e, TREB, TREB-, TREB-5, TREB5, XBP-, XBP-1
Definition
(RefSeq) X-box binding protein 1
  KO
K09027  X box-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22433 (Xbp1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22433 (Xbp1)
   05012 Parkinson disease
    22433 (Xbp1)
   05014 Amyotrophic lateral sclerosis
    22433 (Xbp1)
   05017 Spinocerebellar ataxia
    22433 (Xbp1)
   05022 Pathways of neurodegeneration - multiple diseases
    22433 (Xbp1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    22433 (Xbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22433 (Xbp1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    22433 (Xbp1)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf KASH_CCD YabA CASP_C TSC22 FtsL GAS DivIC Macoilin
Other DBs
NCBI-GeneID: 22433
NCBI-ProteinID: NP_038870
MGI: 98970
Ensembl: ENSMUSG00000020484
Vega: OTTMUSG00000006338
UniProt: O35426
Position
11 A1; 11 3.61 cM
AA seq 267 aa
MVVVAAAPSAATAAPKVLLLSGQPASGGRALPLMVPGPRAAGSEASGTPQARKRQRLTHL
SPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENHKLQLENQLLREKTHGLV
VENQELRTRLGMDTLDPDEVPEVEAKGSGVRLVAGSAESAALRLCAPLQQVQAQLSPPQN
IFPWTLTLLPLQILSLISFWAFWTSWTLSCFSNVLPQSLLVWRNSQRSTQKDLVPYQPPF
LCQWGPHQPSWKPLMNSFVLTMYTPSL
NT seq 804 nt   +upstreamnt  +downstreamnt
atggtggtggtggcagcggcgccgagcgcggccacggcggcccccaaagtgctactctta
tctggccagcccgcctccggcggccgggcgctgccgctcatggtacccggtccgcgggca
gcagggtcggaggcgagcgggacaccgcaggctcgcaagcggcagcggctcacgcacctg
agcccggaggagaaagcgctgcggaggaaactgaaaaacagagtagcagcgcagactgct
cgagatagaaagaaagcccggatgagcgagctggagcagcaagtggtggatttggaagaa
gagaaccacaaactccagctagaaaatcagcttttacgggagaaaactcacggccttgtg
gttgagaaccaggagttaagaacacgcttgggaatggacacgctggatcctgacgaggtt
ccagaggtggaggccaaggggagtggagtaaggctggtggccgggtctgctgagtccgca
gcactcagactatgtgcacctctgcagcaggtgcaggcccagttgtcacctccccagaac
atcttcccatggactctgacactgttgcctcttcagattctgagtctgatatccttttgg
gcattctggacaagttggaccctgtcatgtttttcaaatgtccttccccagagtctgcta
gtctggaggaactcccagaggtctacccagaaggacctagttccttaccagcctcccttt
ctctgtcagtggggacctcatcagccaagctggaagccattaatgaactcattcgttttg
accatgtatacaccaagcctctag

DBGET integrated database retrieval system