KEGG   Mus musculus (mouse): 22433Help
Entry
22433             CDS       T01002                                 

Gene name
Xbp1, D11Ertd39e, TREB-5, TREB5, XBP-1
Definition
(RefSeq) X-box binding protein 1
  KO
K09027  X box-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22433 (Xbp1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    22433 (Xbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22433 (Xbp1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    22433 (Xbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf HOOK YabA KASH_CCD CASP_C TSC22 GAS FtsL DivIC Macoilin
Motif
Other DBs
NCBI-GeneID: 22433
NCBI-ProteinID: NP_038870
MGI: 98970
Ensembl: ENSMUSG00000020484
Vega: OTTMUSG00000006338
UniProt: O35426
Position
11 A1; 11 3.61 cM
AA seq 267 aa AA seqDB search
MVVVAAAPSAATAAPKVLLLSGQPASGGRALPLMVPGPRAAGSEASGTPQARKRQRLTHL
SPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENHKLQLENQLLREKTHGLV
VENQELRTRLGMDTLDPDEVPEVEAKGSGVRLVAGSAESAALRLCAPLQQVQAQLSPPQN
IFPWTLTLLPLQILSLISFWAFWTSWTLSCFSNVLPQSLLVWRNSQRSTQKDLVPYQPPF
LCQWGPHQPSWKPLMNSFVLTMYTPSL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggtggcagcggcgccgagcgcggccacggcggcccccaaagtgctactctta
tctggccagcccgcctccggcggccgggcgctgccgctcatggtacccggtccgcgggca
gcagggtcggaggcgagcgggacaccgcaggctcgcaagcggcagcggctcacgcacctg
agcccggaggagaaagcgctgcggaggaaactgaaaaacagagtagcagcgcagactgct
cgagatagaaagaaagcccggatgagcgagctggagcagcaagtggtggatttggaagaa
gagaaccacaaactccagctagaaaatcagcttttacgggagaaaactcacggccttgtg
gttgagaaccaggagttaagaacacgcttgggaatggacacgctggatcctgacgaggtt
ccagaggtggaggccaaggggagtggagtaaggctggtggccgggtctgctgagtccgca
gcactcagactatgtgcacctctgcagcaggtgcaggcccagttgtcacctccccagaac
atcttcccatggactctgacactgttgcctcttcagattctgagtctgatatccttttgg
gcattctggacaagttggaccctgtcatgtttttcaaatgtccttccccagagtctgcta
gtctggaggaactcccagaggtctacccagaaggacctagttccttaccagcctcccttt
ctctgtcagtggggacctcatcagccaagctggaagccattaatgaactcattcgttttg
accatgtatacaccaagcctctag

DBGET integrated database retrieval system