KEGG   Mus musculus (mouse): 22436Help
Entry
22436             CDS       T01002                                 

Gene name
Xdh, XO, Xor, Xox-1, Xox1
Definition
(RefSeq) xanthine dehydrogenase
  KO
K00106  xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00232  Caffeine metabolism
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    22436 (Xdh)
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    22436 (Xdh)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    22436 (Xdh)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    22436 (Xdh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22436 (Xdh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     22436 (Xdh)
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     22436 (Xdh)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   22436 (Xdh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Motif
Other DBs
NCBI-GeneID: 22436
NCBI-ProteinID: NP_035853
MGI: 98973
Ensembl: ENSMUSG00000024066
UniProt: Q00519 Q9CVF2
Position
17 E2; 17 45.25 cM
AA seq 1335 aa AA seqDB search
MTRTTVDELVFFVNGKKVVEKNADPETTLLVYLRRKLGLCGTKLGCGEGGCGACTVMISK
YDRLQNKIVHFSVNACLTPICSLHHVAVTTVEGIGNTKKLHPVQERIAKSHGSQCGFCTP
GIVMSMYTLLRNKPEPTVEEIENAFQGNLCRCTGYRPILQGFRTFAKDGGCCGGSGNNPN
CCMSQTKDQTIAPSSSLFNPEDFKPLDPTQEPIFPPELLRLKDTPRKTLRFEGERVTWIQ
VSTMEELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPLIICPAWILELTSVAHGPEGIS
FGAACPLSLVESVLADAIATLPEQRTEVFRGVMEQLRWFAGKQVKSVASIGGNIITASPI
SDLNPVLMASRAKLTLASRGTKRTVWMDHTFFPGYRRTLLSPEEILVSIVIPYSRKGEFF
SAFKQASRREDDIAKVTSGMRVLFKPGTTEVQELSLCFGGMADRTVSALKTTPKQLSKSW
NEELLQDVCAGLAEELHLAPDAPGGMVEFRRTLTLSFFFKFYLTVLQKLGRADLEGMCGK
LDPTFASATLLFQKDPPANVQLFQEVPKGQSEEDMVGRPMPHLAADMQASGEAVYCDDIP
RYENELSLRLVTSTRAHAKIMSIDTSEAKKVPGFVCFLTSEDVPGSNITGIFNDETVFAK
DEVTCVGHIIGAVVADTPEHAHRAARGVKITYEDLPAIITIQDAIKNNSFYGPEVKIEKG
DLKKGFSEADNVVSGELYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNTMKTQSFIA
KMLGVPDNRIVVRVKRMGGGFGGKETRSTLISTAVALAAYKTGRPVRCMLDRDEDMLITG
GRHPFLAKYKVGFMKTGTIVALEVAHFSNGGNSEDLSRSIMERAVFHMDNAYKIPNIRGT
GRICKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAVTCGLPAEEVRRKNMYKEGDLTHFNQ
KLEGFTLPRCWDECIASSQYQARKMEVEKFNRENCWKKRGLCIIPTKFGISFTLSFLNQG
GALVHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHITETSTNTVPNTSPT
AASASADLNGQAIYEACQTILKRLEPFKKKNPSGSWESWVMDAYTSAVSLSATGFYKTPN
LGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEG
AFVQGLGLFTMEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKRAIYASK
AVGEPPLFLASSIFFAIKDAIRAARAQHGDSNAKQLFQLDSPATPEKIRNACVDQFTTLC
ATGTPENCKSWSVRI
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggacaacggtagatgagttggtcttctttgtgaatggcaaaaaggtggtggag
aaaaatgcagaccctgaaacaacacttctggtctaccttagaagaaagttggggctgtgc
gggaccaagcttggctgtggagaaggtggctgtggggcatgcaccgtgatgatctccaag
tatgaccgccttcagaacaagatcgttcatttttccgtcaatgcctgcttgacccccatc
tgctccttgcatcatgttgctgtgacaactgtggaaggcataggaaacaccaagaagctg
catcctgtccaggagagaattgccaaaagccatggttcccagtgtgggttctgtacccct
ggtattgtcatgagtatgtacacactgctccgaaacaagcctgagcctactgtcgaggag
atcgagaatgccttccaaggaaacctctgccgctgtacaggctatagacccatcctccag
ggattccggacctttgccaaggatggtgggtgctgtggaggaagtggaaacaacccaaac
tgctgcatgagccaaacaaaggaccagacgattgctccctcatcttctttattcaacccg
gaggatttcaaacctttagatcccacccaagagcccatctttcccccagagttgctgagg
ctgaaagacactccccggaagacgttgcgttttgaaggggaacgtgtgacctggatccag
gtttcaaccatggaggaactgcttgacctcaaagcccagcaccctgatgccaagctggtg
gtgggaaacacagagataggcattgaaatgaaatttaaaaatatgctatttcctctgatc
atctgcccagcctggatccttgaactgacctcagtggcacatgggcctgagggaatctcc
tttggagccgcttgcccccttagcttggtggaaagtgtcctggcggacgcgattgctaca
cttccagagcagaggacagaggtgttcagaggcgtgatggagcagctgcgctggtttgct
ggcaagcaggtcaagtccgtggcgtccattggcgggaacatcatcaccgcgagccccatc
tctgacctcaaccctgtgctcatggccagtcgagccaagctgaccctcgcatctagaggt
accaagagaacggtctggatggaccataccttcttccctggctatagaaggactctgctc
agtccagaggagatattggtgtccattgtgatcccctacagcaggaagggtgagtttttc
tcagccttcaagcaggcctccaggagagaagatgacattgccaaggtgaccagtggcatg
agagtcctgttcaagccagggaccactgaagtgcaggaactgtccctttgctttggaggg
atggctgacagaactgtctcagccctcaagaccactccgaagcagctgtccaagtcctgg
aatgaggagttgctgcaggatgtgtgtgctggcttggcagaggagctgcacctggccccc
gacgcccctggtgggatggtggaattccggcgcaccctcaccctcagcttcttcttcaag
ttctacctgacagtgcttcagaagctgggcagagcggaccttgagggtatgtgtggtaaa
ctggaccccacctttgccagcgccaccctgctctttcagaaggatcctccagctaacgtc
cagcttttccaagaggtgcccaagggtcagtctgaggaggacatggtgggcaggcccatg
cctcacctggcagcagacatgcaggcatccggggaggctgtgtactgtgatgacattccc
cgctatgagaatgagctgtccctcaggctggtcaccagcacgcgggcccatgctaaaatc
atgtccatcgacacttcagaagccaagaaggtgccagggtttgtttgtttcctcacctca
gaggatgtccctggtagtaacataactggcattttcaatgatgaaactgtctttgcgaag
gatgaggttacttgtgttgggcacatcattggtgctgtggtcgctgacaccccagaacat
gcacacagagccgctagaggggtgaaaatcacctatgaagaccttccagccattatcaca
atccaggatgctataaagaacaactccttttatggccccgaggtaaaaatcgagaaagga
gatctcaagaaaggcttttctgaagctgacaatgttgtctcaggagaattatatattggt
ggccaggagcacttctatctggagacccactgcaccattgccgtgccgaaaggcgaggca
ggcgagatggagctcttcgtgagcacacagaacaccatgaaaacccagagctttattgca
aagatgttgggtgttccagacaacagaattgtagtccgagtgaaaagaatgggtggaggc
tttggagggaaggagacccggagcactctgatatccacagcagtggccttggctgcatac
aagacaggccgccctgtacgttgcatgctggaccgagacgaggacatgctcataactggt
ggcagacatcccttcctggctaaatacaaggtgggcttcatgaagactgggactatagtg
gcactggaggtggctcacttcagcaatggcgggaacagtgaggatctctctcggagtata
atggaaagagctgtattccacatggacaacgcctataagatccccaacattcgcggcacc
gggaggatttgtaagactaatctgccctctaacacagccttcagaggctttgggggtcct
caggggatgctaatcgcagaatactggatgagtgaggtcgctgtcacctgtgggctgcct
gcagaggaggtacggaggaaaaacatgtacaaagaaggggacctgactcacttcaaccag
aagctggaggggttcaccttgcccaggtgctgggatgagtgcatagcgagctcccagtat
caggctcgcaagatggaagtggagaaattcaacagggagaactgttggaaaaagagaggg
ctgtgtataatcccgactaagtttggaataagcttcacactttcttttctgaaccagggg
ggtgccttggtccacgtgtacacggatgggtcggtgctgctgacacatggaggtactgag
atgggtcaaggccttcacaccaagatggttcaggtggccagcagagctctgaaaatcccc
acttccaagatccatataacggagacaagcactaacactgtccctaacacctctcccacg
gctgcctctgccagcgctgacctcaatggccaggccatttatgaagcctgtcagaccata
ctgaaaagactggagcccttcaagaaaaagaatccctcaggctcctgggagagctgggtc
atggatgcctacactagtgcagtgagcttgtctgctactggattttataagacacccaac
cttggttacagctttgagacaaactctgggaaccccttccactacttcagttatggggtg
gcttgctcagaagtagaaattgactgcttaacaggggaccataagaatctccgtacagat
atcgtcatggatgttggttccagcttgaatcctgccattgatatcggacaggtagaaggg
gcatttgtccagggtcttggtcttttcaccatggaggagctgcactactctcccgagggg
agcctgcacactcgtggccccagtacctacaagatccctgcatttggcagcatccccatt
gagttcagagtatccctgctccgcgactgccccaacaagagggccatctatgcatccaag
gctgtcggcgagccacctcttttcctggcttcttcgatcttctttgccatcaaagatgcc
atccgcgcagctcgagctcagcacggagacagtaacgccaaacagctcttccagctagac
agccccgccactccggagaagatccgaaacgcttgtgtggatcagttcaccaccctgtgt
gccactggaacaccagaaaactgtaaatcctggtccgtgaggatctga

DBGET integrated database retrieval system