KEGG   Mus musculus (house mouse): 224405
Entry
224405            CDS       T01002                                 
Symbol
Cyyr1
Name
(RefSeq) cysteine and tyrosine-rich protein 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: CYYR1 Shisa
Other DBs
NCBI-GeneID: 224405
NCBI-ProteinID: NP_659102
MGI: 2152187
Ensembl: ENSMUSG00000041134
UniProt: Q8VIH7
Position
16:complement(85249746..85347793)
AA seq 165 aa
MDALRLPRRPGVLLPKLILLFVYAGDCLAQCGKECHSYCCDGSTPYCCSYYAYIGNILSG
TAIAGIVFGIVFIMGVIAGIAICICMCMKNNRGTRVGVIRAAHINAISYPMAPPPYTYDH
EMEYRTDLPPPYSAAPQASAQRSPPPPYPGNPRKYSSSQNRIRDN
NT seq 498 nt   +upstreamnt  +downstreamnt
atggacgcgctgaggctgccccggcgtccaggggtcctgcttccgaagttgatcctgctc
tttgtttatgcaggggattgcctggcgcagtgtggcaaagagtgccactcttactgctgc
gacggtagcacgccctactgctgctcctactacgcctatattgggaacattctctcgggc
acggcgattgctggcatcgtgtttggaatcgtgttcatcatgggggtcattgcaggaatc
gccatctgcatctgcatgtgcatgaagaacaaccgggggacccgcgtgggggtcatcaga
gcagcacacatcaacgccatctcctatcccatggcaccacccccctatacttatgaccac
gagatggaatatcgcacagacctgccacctccatactctgcagccccacaggcttcggcc
cagcgctctccaccccctccgtatcctggaaatccaaggaaatattcctcctcccagaac
agaatacgtgacaattag

DBGET integrated database retrieval system