KEGG   Mus musculus (mouse): 22441
Entry
22441             CDS       T01002                                 

Gene name
Xlr
Definition
(RefSeq) X-linked lymphocyte-regulated
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Cor1 Amidoligase_2 Mgr1 DUF4168 Exonuc_VII_L DUF1911
Other DBs
NCBI-GeneID: 22441
NCBI-ProteinID: NP_001278676
MGI: 98976
Ensembl: ENSMUSG00000054626
Vega: OTTMUSG00000017392
UniProt: P05531 Q544L6 Q8BS74
Position
X; X A5
AA seq 208 aa
MENWDLSSDEMQDGNAPELDVIEEHNPVTRDDENANPEEVVGDTRSPVQNILGKFEGDIN
KRLHIKRKRMETYIKDSFKDSNVKLEQLWKTNKQERKKINNKFCEQYITTFQKFDMDVQK
FNEEQEKSVNNYQKEQQALKLSKCSQSQTLEAIKDMHENYMEGLMNLETNNYNMLFDVDG
ELRKEMSVFKKDLMKHTLKYSSSFPSSD
NT seq 627 nt   +upstreamnt  +downstreamnt
atggaaaactgggacttgtcaagtgatgaaatgcaagatgggaatgctccagaattggac
gttattgaagaacataatccagtaactcgtgatgatgagaatgcaaatcctgaagaagta
gttggagatacacgatctccagtacaaaatattctgggaaaatttgaaggtgacattaac
aagaggcttcacataaagagaaaacgcatggaaacttatatcaaagattctttcaaagac
agcaacgtgaaattagaacaactttggaaaacgaacaaacaagagagaaagaagattaac
aacaaattttgtgagcagtatataactacatttcagaagtttgatatggatgtccagaaa
ttcaatgaagaacaagaaaaatcagtgaacaattatcaaaaagaacaacaagcattaaaa
ctgtccaaatgtagtcagagccagaccctggaagcaattaaagacatgcatgaaaactac
atggagggtctgatgaacttggagaccaacaactacaatatgctttttgatgtagatggt
gaactgagaaaagaaatgtcagtgtttaaaaaagacctcatgaagcatactctgaagtac
tcttctagtttcccatcttcagactaa

DBGET integrated database retrieval system