KEGG   Mus musculus (mouse): 22446
Entry
22446             CDS       T01002                                 

Symbol
Xlr3c, Xlr, Xlr3b
Name
(RefSeq) X-linked lymphocyte-regulated 3C
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Cor1 DUF1374 RHH_1 CPG4 CHD5
Other DBs
NCBI-GeneID: 22446
NCBI-ProteinID: NP_035857
MGI: 3047103
Ensembl: ENSMUSG00000058147
Vega: OTTMUSG00000017650
UniProt: B1B0S0
Position
X; X A7.3
AA seq 226 aa
MSSRKRKATDTAGRHSRMDPNLSSDDSQNPGAVAAANREVLDAGREDIISSGTERQQARK
EKQDLVQEFEEPRNKVLQENREKFSRIMTSSFSAMEVKIKDVLKTHCEERQKLCQDYSLQ
FTNLNRKLTSDAYKLKKHAETLSNMFMEQQKFIHESLTLQKNRMKEFKSLCEKYLEKLEV
LRDSRGNSIAEELRRLIATLEIKLLMLHNQQKTAAPPQSLLDVLFS
NT seq 681 nt   +upstreamnt  +downstreamnt
atgtcaagcagaaaaaggaaggccactgacactgctggcaggcactcaaggatggatcca
aatctctcctcagatgacagccagaacccaggtgcagtcgcagcagctaacagagaagtc
cttgatgctggtagggaggacattatttcctcaggaacagagaggcaacaggccaggaag
gaaaaacaggacttggtccaagaattcgaagagccacgtaacaaagttcttcaggaaaac
agagaaaaattctcaaggatcatgacctcatctttcagtgccatggaggtcaaaattaag
gatgttctgaaaacccactgtgaagagaggcagaaactttgtcaggactattctcttcag
tttacaaatttgaataggaagttaacttcggatgcatacaaactcaagaaacatgccgaa
acactctctaatatgtttatggagcaacagaagtttattcatgaaagtctcactcttcag
aagaacagaatgaaggaatttaaatcactgtgtgaaaaatacttggagaaactggaggta
ctgagggattctcggggaaattccatcgctgaagagctgagacgtcttatagccaccttg
gaaatcaaacttctgatgctgcataaccagcaaaagactgctgctcctccacagtctctc
ctggatgtgttattctcataa

DBGET integrated database retrieval system