KEGG   Mus musculus (mouse): 224481
Entry
224481            CDS       T01002                                 

Gene name
Tfb1m, AI429207, mtTFB1
Definition
(RefSeq) transcription factor B1, mitochondrial
  KO
K15266  dimethyladenosine transferase 1, mitochondrial [EC:2.1.1.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    224481 (Tfb1m)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    224481 (Tfb1m)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     224481 (Tfb1m)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   224481 (Tfb1m)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial transcription factors
    224481 (Tfb1m)
SSDB
Motif
Pfam: RrnaAD
Other DBs
NCBI-GeneID: 224481
NCBI-ProteinID: NP_666186
MGI: 2146851
Ensembl: ENSMUSG00000036983
UniProt: Q8JZM0
Structure
PDB: 
4GC5 4GC9

Position
17; 17 A1
AA seq 345 aa
MAASGKLGTFRLPPLPTIREIIKLFGLRAVKQLSQNFLLDLRLTDKIVRKAGSLADVYVY
EVGPGPGGITRSILNANVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTYKIEKA
FPGNIRRQWEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKDGPFVYGRTKMTLTFQKEV
AERLVATTGSKQHSRLSIMAQYLCNVEHLFTIPGKAFVPKPKVDVGVVHLTPLIEPKIKQ
PFKLVEKVVQNAFQFRRKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHF
KSLCDVYRKMCDEDPQLFTYNFREELKQKKSKGQEKDGDPESCGF
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggctgcctcggggaagctcggcactttccgccttcccccgttgcccaccattcgggag
atcattaagttgttcggactgcgagcggtgaaacagctttcccagaatttcctcctggac
ttgaggctgacagacaagattgtaaggaaagctggcagtctagcagatgtttatgtttat
gaagtgggtcctgggcccgggggaatcacaagatccatcctgaatgccaacgttgctgag
cttctggtggttgaaaaggacactcgctttatcccagggttacagatgctctctgatgca
gcacctggaaaactccgaattgttcatggagatgtgctgacatacaagatagaaaaggct
tttccaggcaacattagaagacagtgggaagatgatcctccaaatgtacacattattgga
aatctaccttttagtgtttcaactccactgattatcaagtggcttgaaaatatttctctt
aaagatggccctttcgtttatggcagaactaagatgacgttaacgtttcaaaaggaagtg
gctgagagacttgtagccactacaggaagcaaacagcacagtcgcctttccattatggcc
cagtacctctgcaatgttgaacacctctttacaatcccaggaaaagcttttgttcccaaa
ccaaaagttgatgtaggagtggtgcaccttacgcccttgatagagcccaagatcaagcag
ccattcaagctggtagaaaaagttgtccagaatgcgtttcagtttcgaaggaaatattgc
caccgagggcttggaatgttattccctgaagcacaacgcctcgaaagcactggaaggctg
ttacagttggcagacattgatccaactctccggcccacccacctctcgctcatgcatttt
aagagtttgtgtgatgtatacagaaaaatgtgtgatgaagacccacaactctttacttat
aacttcagagaggagctcaagcaaaagaaaagtaaaggccaagaaaaagatggtgaccca
gaaagctgcgggttctaa

DBGET integrated database retrieval system