KEGG   Mus musculus (house mouse): 224530
Entry
224530            CDS       T01002                                 
Symbol
Acat3, ACTL
Name
(RefSeq) acetyl-Coenzyme A acetyltransferase 3
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00380  Tryptophan metabolism
mmu00620  Pyruvate metabolism
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu00650  Butanoate metabolism
mmu00900  Terpenoid backbone biosynthesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01212  Fatty acid metabolism
mmu04975  Fat digestion and absorption
Module
mmu_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    224530 (Acat3)
   00630 Glyoxylate and dicarboxylate metabolism
    224530 (Acat3)
   00650 Butanoate metabolism
    224530 (Acat3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    224530 (Acat3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    224530 (Acat3)
   00310 Lysine degradation
    224530 (Acat3)
   00380 Tryptophan metabolism
    224530 (Acat3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    224530 (Acat3)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    224530 (Acat3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    224530 (Acat3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     224530 (Acat3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   224530 (Acat3)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Dodecin
Other DBs
NCBI-GeneID: 224530
NCBI-ProteinID: NP_001397206
MGI: 109182
Ensembl: ENSMUSG00000062480
Position
17:complement(13142720..13159482)
AA seq 397 aa
MNTRSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRAKVAPEEVSEVIFGHV
LTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGME
NMSKAPHLTHLRTGVRVGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDK
VAVLSQNRAEHAQKAGHFDKEIVPVLVSSRKGLTEVKIDEFPRHGSNLEAMGKLKPYFLT
DGTGTVTTANATGMNDGAAAVVLMKKTEAERRMLKPLARIVSWSQAGVEPSVMGVGPIPA
IKQAVAKAGWSLEDVDLFEINEAYAALSVAIAKELGLNPEKVNINGGAIALGHPLGASGC
RILVTLLHTLERVGGTRGVAALCIGGGMGVAMCVQRG
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgaacacaagatccgacccagtggtcatcgtctcggcggcccgtaccgccataggctcc
ttcaatggtgccctgtccaccgtgcctgtccacgaaatggggacaactgtcatcaaagaa
gtcctgcagagggccaaggtggctccagaagaggtgtccgaggtcatatttggacatgtc
ttgacggcaggttgtgggcagaatcctactcgacaagccagtgtgggtgcagggatcccc
tattcggttccagcatggagctgccagatgatctgtggctcgggcctaaaagccgtgtgt
cttgcagcccagtccatagccatgggcgactccaccattgtggtagctggaggcatggag
aatatgagcaaggctcctcacttgactcacctgagaacaggagtcagggtgggtgaggtg
ccactggctgacagcatactctgtgatggtctgacagatgcctttcacaactaccacatg
ggcatcacagctgaaaacgtagccaaaaaatggcaagtgagcagagaggcccaggacaag
gttgcagttctgtcacagaacagggcagagcatgctcagaaagctggccactttgacaag
gagattgtgccagtgctggtgtcttccagaaaaggtcttactgaagtgaaaatcgatgaa
tttccccgtcatgggagtaaccttgaagccatgggcaagctgaaaccttactttcttact
gatgggacaggaactgtcacaactgctaatgcaacaggaatgaacgatggcgctgctgct
gtggtccttatgaagaagacagaagctgagaggcggatgctgaaacctttagcaagaata
gtctcctggtcccaagccggtgtggagccttctgttatgggagtaggaccaattccagcc
ataaagcaagctgttgcaaaggcaggctggtccttggaggatgttgacctgtttgaaatc
aatgaagcctatgcagctctctctgttgcaatagctaaagaacttggactaaaccccgag
aaggtcaacatcaatggaggagccattgccttgggccatcctctgggagcatctggctgc
aggattctagtgaccttgctgcacaccctggagagagtgggcgggacccgtggtgttgca
gccctgtgcattgggggtgggatgggagtcgcaatgtgtgttcagagagggtga

DBGET integrated database retrieval system