KEGG   Mus musculus (mouse): 224648Help
Entry
224648            CDS       T01002                                 

Gene name
Uhrf1bp1, 1110020K19Rik, AA408674, F830021D11Rik, mKIAA4127
Definition
(RefSeq) UHRF1 (ICBP90) binding protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Chorein_N
Motif
Other DBs
NCBI-GeneID: 224648
NCBI-ProteinID: NP_001074238
MGI: 3041238
Ensembl: ENSMUSG00000039512
Vega: OTTMUSG00000023192
UniProt: B2KF50
Position
17; 17 A3.3
AA seq 1429 aa AA seqDB search
MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLTHLELDEEVLQNVLELPTWLAITR
VYCNRASIQIQWTKLKTHPICLCLDKVEVEMQTCEDPRPPNGQSPIALASGQSEYGFAEK
VVEGMFIVVNSITIKIHSKAFHASFELWQLQGYSVNPNWQQSDLRLTRITDPRRGEVLTF
KEITWQTLRVEADAIENGDQDPVTTPLRLITNQGRIQIALKRRTKDCNVVASKLTFLLDD
LLWVLTDSQLKAMMKYAESLSEAMEKSAQQRKSLAPESVQTTPPAPSAQQTWAQAFGGSQ
GSSSSSRLSQYFEKFDVKESSYHLLISRLDLHICDDSQSREPGVSANRLTGGAMQLTFRR
MAFDYYPFHRAGDSCKHWVRHCEAMETRGHWAQQLVTEFQSRVEKQCEGGSVKPPWLLGV
DPPFRRKADSFSSPGKTPLDKSPTQGRQAAFGAPAWNRLRSSCLVVRVDDLDIHQVSTAG
QPSKKPSTLLSCSRKRHHLPPQVAAIHVQFTEYYFPDNQELPVPCPNLYIQLNGLTFTVD
PVSLLWGNLFCLDLYRSLEQFKAIYKLEASRGRDEHVDVRLDAFWLKVSFPLETRELAKL
HRPQALVLSTSSMIATNTRHAPNCTRPDLQSLFRGFAATEFFRCSYGHFPQVAGGFSLLH
MLFLHHAFQMDSLPPQRLAASQDLWSLHFTQISLDFEGTENFRGHTLNFVAPFPLSIWAC
LPLRWQQAQARRLLLASEGRLKQSASFGSPVHSEALAPESVSHQRSKTERDLKSLSGSTE
GPAAAVREGDAGVDHKGRVADLEDVADIHMLVHSTAHVRVRLDHYQYLALLRLKEVLEGL
QEQLTKDTEAMTGSPLQDQTVCIGVLFPSAEVALLMHPAPGTAHADSAGSDTTSLIDSEL
SPSEDREPKSDASSDQGAVSPEKVLRDGSGENLAASQERLPSDGELPDPGPCAQQPVGKS
HEAVESLQAKKLSRAQSARSPATLKSPADRDAALNGQGEPVPLRSIEGDLSSAIHMTKDA
TKEALHATVDLTKEAVSLTRDAFSLGRDRMTSTMHKMLSLPPAKEAMAKPDEGVVASVSG
GAARLRFFSMKRTVSQQSFDGVSLDSGGPDDRISVDSDGSDSFVMLLESESGPESVPPGS
VTSVLDDSGIQGSPVTDSGGQGLPETNSSASASGDLVMHSVSILVLKVNEVSLGIEVRGE
DLAVALQAEELALQQLGTVGLWQFLHGQCPGAGFQEPSNLKTNPIRPAVGLRFEVGPGAA
VHSPLATQNGFLQFLLRGCDLELFTSVLNGLGPFLEDEEVPVVVPMQIELLDCRVTLKDD
IPPVYPTSPGPVPITLAMERLVLKRGDDGVFHLGAPAHDRPLTDVPEKLRLPKEQVLLVP
LGQGLGCQEKESPTLQQELMDTKQALAIANQDKEKLLQEVRKYNPLFEL
NT seq 4290 nt NT seq  +upstreamnt  +downstreamnt
atggccgggatcattaagaagcagatcttgaagcatctgtcccggttcactaagaatctt
tccccggacaaaatcaacttgagcactctgaaaggggagggtcagctgacccatctggag
ctggacgaagaggttctgcagaatgttctggaattgcctacctggctggccatcactagg
gtctactgcaatcgggcctccatccagatccagtggaccaagttgaagacacacccgatc
tgcttgtgtctggataaggtggaggtggagatgcagacctgtgaggaccctcgccccccc
aacgggcagtctcctatcgcccttgcctcgggacagagtgagtatggctttgctgagaag
gtggtggagggaatgttcattgtggtcaactccatcaccatcaagatccactccaaggcc
ttccatgcttcctttgaactgtggcagctccagggttatagtgtcaaccccaactggcag
cagagtgacctgcgtctgacccgcatcactgatccccgccgaggagaggttttaacattt
aaggaaataacttggcagaccctccgagttgaggcagacgccatagaaaatggtgatcag
gacccagttaccaccccactgaggctcattaccaaccaaggccgcatccagatagccctc
aagagaagaaccaaagactgcaatgtggtcgcctccaagttgaccttcctcctggacgac
ctgctctgggtgctgacggactcacagctcaaggcgatgatgaagtacgccgagtcgctg
agtgaggccatggagaagtctgcccagcagagaaagagcctggctcctgagtctgtgcag
accactccacccgctcccagtgctcagcagacttgggcccaggcattcggtggcagccag
ggcagcagcagcagcagtcgtctcagccagtattttgagaaatttgacgtgaaggagtct
tcctaccacctcctcatctcccgcctggacctgcacatctgcgatgacagccagtcccga
gagccaggtgtctctgcaaacagactcacgggtggtgctatgcagctcaccttccgcagg
atggcgtttgactactaccccttccatcgggcaggtgacagctgtaaacactgggtgcgg
cactgtgaggccatggaaacccgaggccactgggcccagcaactggtgacagagtttcag
agtcgggtggagaagcagtgtgaggggggcagtgtgaagcccccgtggctgttgggggtg
gaccctcccttccggaggaaagcagattctttctctagtcctggaaagacccctctggac
aaaagccctactcagggccggcaggctgcctttggggctccagcatggaatcgcttacgc
tctagctgcctggttgtacgagtagatgacttggacatccaccaggtttccacagctgga
cagccaagtaagaagccgtccactctgctctcctgcagccgcaagcgccaccacctcccg
cctcaggtggctgccatccacgtacagttcacagagtattacttcccggataatcaggag
cttccggttccctgtcccaatctctacatccagttaaacgggctgacgtttaccgtggat
cctgtcagcttgctttggggaaacctcttttgtctagatttataccgaagcttggagcag
tttaaagccatctataagctggaagcttcgaggggaagagatgagcacgtggacgtccga
ctggacgcattctggttgaaggtgagcttccccctggagacgagagagctggcgaagctg
catcgcccccaggcgctggtcctctccacgtcctccatgattgccaccaatacccggcat
gccccgaactgcactcgcccagacctccaaagtctcttccggggattcgctgccaccgag
ttctttcgttgtagctacggtcactttccccaggtggcagggggcttcagccttctgcac
atgctcttcctgcaccatgctttccagatggactccctccctcctcagaggctggccgca
tcccaggatctttggtccctgcatttcacccagatctccttggactttgaaggcacagaa
aacttcagaggccataccctgaattttgtggctcccttccccttgtccatttgggcctgc
cttcctctccgctggcagcaagcccaggcacgacggctccttttggcttcggaagggagg
ctaaaacagtcagccagctttggcagtcctgtgcactctgaagcccttgcccctgagtct
gtgtcccatcagaggtcaaagacagagcgagatttgaagagcctctcaggctctacagaa
ggcccggcagcggcggtgagagaaggtgatgctggtgtggaccacaaaggccgtgtggca
gacctggaggatgtggctgacattcacatgcttgtccactccaccgcccatgtcagagtg
aggctcgaccactaccagtacttggctctgctgcgcctcaaggaggtgctagagggcctt
caggagcagctgacaaaggacacagaggccatgaccgggtctcccctgcaggaccagacc
gtgtgcattggcgttctcttccctagtgccgaggtggctctcctcatgcatcctgcccct
gggactgctcacgcggactctgcaggctcagacaccaccagcctcatagactctgagctg
tcaccatccgaggaccgggagccgaagtctgatgcctcctcagaccagggcgcagtaagc
cccgagaaggtgctgagggacggcagcggtgagaacctggctgcgtcccaggagaggctg
cccagcgatggagagctaccagacccaggcccatgtgcacagcagccagtagggaagagc
cacgaggcggtcgagtctctccaggccaagaagctaagccgagctcagagtgccaggtcc
ccggctacgctgaagtccccggcggacagggatgctgctctgaacggccaaggcgagccc
gtgcccttgaggagcattgagggggacctgtccagcgctattcacatgaccaaggacgcc
accaaagaggcgcttcacgctaccgtggacctcaccaaggaggctgtgtccctgactagg
gatgccttcagtttggggagagatcgaatgacttctaccatgcacaagatgttgtccttg
cctcctgccaaggaggccatggccaagccagatgagggggtggtggcctcagtgagtggg
ggtgctgcccggctccggtttttctccatgaagaggacagtctctcagcagtcatttgac
ggtgtctcgttggacagcggtggccccgacgaccggatttcggtggacagcgatggaagt
gacagctttgtgatgctcttggagtctgaatctggtccagagtctgttccaccaggatct
gtcacaagcgtcttggatgatagtggcatccaggggagccctgttacggatagtggtggc
caggggttgccagagaccaacagctcagcgtcagccagcggagacctcgtcatgcactcg
gtgtcaatactggtcttgaaggtgaacgaagtatcacttgggattgaggttcgtggtgag
gacctggctgtagccttgcaagcagaagagctggccctgcagcagctgggcaccgtggga
ctctggcagtttctacatggacagtgcccaggcgcaggttttcaagaaccctcaaatctg
aagaccaaccccatcaggcctgctgtgggtctgcgctttgaggtggggcctggtgcagct
gttcattccccgctggccacacaaaatggcttcctgcagttcttacttcggggctgtgac
ctggagctgttcacctcagtgctcaacggtctggggcctttcttggaggatgaggaggtc
ccggtggtggtccccatgcagatcgagctcctggactgcagggtcactctcaaggatgac
atccctcccgtctacccaacatcccctggccctgtccccatcactttggcaatggagcgt
cttgtgctgaagcgaggtgacgatggagtgtttcaccttggtgctcctgctcacgacaga
ccattgactgacgtgcctgagaagctgcggctccctaaagagcaggtgctcctggtgccc
ctaggccagggcttgggatgccaggagaaagaatcgcctaccctccagcaagagcttatg
gacaccaaacaagcactggccattgccaaccaggacaaagaaaaactgctccaggaggtt
aggaaatacaaccctctctttgagctttga

DBGET integrated database retrieval system