KEGG   Mus musculus (mouse): 224650
Entry
224650            CDS       T01002                                 

Gene name
Anks1, Anks1a, mKIAA0229
Definition
(RefSeq) ankyrin repeat and SAM domain containing 1
  KO
K21413  ankyrin repeat and SAM domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    224650 (Anks1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    224650 (Anks1)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3 SAM_1 SAM_2 PID PID_2 PTB
Other DBs
NCBI-GeneID: 224650
NCBI-ProteinID: NP_852078
MGI: 2446180
Ensembl: ENSMUSG00000024219
Vega: OTTMUSG00000024177
UniProt: P59672
Position
17; 17 A3.3
AA seq 1150 aa
MGKEQELLEAARTGHLPAVEKLLSGKRLSSGFGGGGGGSGSGGGSGGGGLGSSSHPLSSL
LSMWRGPNVNCVDSTGYTPLHHAALNGHRDVVEVLLRNDALTNVADSKGCYPLHLAAWKG
DAQIVRLLIQQGPSHTRVNEQNALEIRELKKYGPFDPYINAKNNDNETALHCAAQYGHTE
VVKALLEELTDPTMRNNKFETPLDLAALYGRLEVVKLLLGAHPNLLSCSTRKHTPLHLAA
RNGHKAVVQVLLDAGMDSNYQTEMGSALHEAALFGKTDVVQILLAAGIDVNIKDNRGLTA
LDTVRDLPSQKSQQIAALIEDHMTGKRSVKEVDRTSTAQLPLLSNTDAIAPMSQGSMEKT
VTELILHFDTHADEEGPYEALYNAVSCHSLDSTASGRSSDRDSMNKEAEATGTRAAGVRP
RERPPPPAKPPPDEEEEERVDKKYFPLAASEGLAVRPRIQSSAPQEEEEHPYELLLTAET
KKLGTTDGRTEDHRQSGSGRSQDSVEGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLTAP
SQSHPESSQQDACHEASMQLEEPGVQGTEPPQPGVPDQSKRVGLPAGLTALASRTYLDAL
THTVPLRPAGAEEEDQSGPRSRAPPTSKPKAELKLSRSLSKSDSDLLTCSPTEDATMGSR
SESLSNCSIGKKRLEKSPSFASEWDEIEKIMSSIGEGIDFSQEQQKISGSRTLEQSVGEW
LESIGLQQYESKLLLNGFDDVRFLGSNVMEEQDLREIGISDPQHRRKLLQAARSLPKVKA
LGYDGVSPTSVPSWLDSLGLQDYVHSFLSSGYSSIDTVKNLWELELVNVLKVHLLGHRKR
IIASLADRPYEEPPQKPPRFSQLRCQDLISQTSSPLSQNDSCTGRSADLLLPSADTSRRR
HDSLPDPGTASRADRFRVQEEPSETKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYEA
NYLGSMLIKDLRGTESTQDACAKMRKSTEHMKKIPTIILSITYKGVKFIDASNKNVIAEH
EIRNISCAAQDPEDLCTFAYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQL
ALQAQKSRTMAASAASMIETKSSKPVPKPRVGMRKSALEPPDSDQEAPSHASVSWIVDPK
PDSKRSLSTN
NT seq 3453 nt   +upstreamnt  +downstreamnt
atggggaaggagcaggagctgctggaggcggcccgcaccgggcacctcccggccgtggag
aagctgctgtccgggaagcggctctcctccggcttcggcggcggcggcggcggctcaggc
agcggcggcggctccgggggcggcggcctcggttcttctagccacccgctctccagtctg
ctgagcatgtggagagggccgaacgtgaactgtgtagatagcaccggctacacgccacta
caccacgctgctttgaatggacacagggatgtggtcgaggtccttctgaggaacgacgcg
ctgaccaacgttgctgactcgaaaggctgctacccgctgcacttggcagcgtggaaagga
gacgcccagatagtacgtctgctcatccagcaagggccctcacacaccagagtcaacgaa
cagaatgctcttgagatcagagaactcaaaaagtacggcccctttgacccttatatcaat
gccaagaacaacgacaatgagacggccctgcactgcgcggcccagtacggccacacggag
gtcgtgaaggctctgctggaggagctcacggaccccaccatgcgcaacaacaagtttgaa
acgcccctggacttggcggcgctgtacgggcggctggaggtggtgaagctgctgctgggt
gcacaccccaatctcctgagctgcagcactcggaaacacacgcccctgcacttggcagca
aggaatggccacaaggccgtggtgcaggtcctgctggacgccggcatggatagcaactat
cagacggagatgggcagtgctttgcatgaggctgctttgtttggcaagaccgatgtggtg
caaatcctgctggctgcaggaatcgatgttaacataaaggataaccgtggcctgactgcc
cttgacactgtccgggatctgccctctcagaagagccagcagatagccgccctgattgaa
gatcacatgaccggaaaaagaagcgtgaaagaagtggacaggacctccacagcccagcta
cctctcctctccaacacagacgccatagcaccaatgtctcaggggagtatggagaagaca
gtgactgagctgatccttcattttgacacacatgctgacgaggagggcccctacgaggca
ctgtacaacgctgtgtcctgccattccttggacagcacggccagtggacgatcatcagac
agagactccatgaacaaggaggccgaggccaccggaacaagggctgctggagtgaggcct
agggaacgtccgccgcctccagcaaaaccgccacccgatgaagaggaggaagaacgcgta
gataagaagtattttcccttggcagcctctgagggcctggctgtgagacccaggattcag
agtagtgctccccaggaagaggaggagcacccatatgagctgctgctcacggcagaaacc
aagaagctggggaccacagacgggaggactgaagaccacaggcagagcggcagcggccgg
agccaggactctgtggaggggcaggacgggcaggtcccagagcagttctcaggtctcctc
cacggctcctccccagtgtgtgaggtggggcaggaccctttccagctgctcacggccccc
agccagagccacccggagtcctcccagcaggacgcctgccacgaggccagcatgcagcta
gaggagccaggcgtgcaaggcactgaacccccgcagcccggcgtccctgaccaaagcaag
agagtgggcttgccggcaggcctgacagccctggccagcagaacatacctcgatgcattg
actcacacagtacctctgcgccctgctggtgccgaggaagaagaccagagcgggcccaga
agcagagcccctcccaccagcaagcccaaagctgagctcaaactcagccgcagtttgtct
aagtctgactctgacctcctgacctgctcccccacggaggacgccacaatggggagtcgc
agcgagtccttgtccaactgcagcatcgggaagaagaggttggagaaatcaccttccttt
gcctcagagtgggatgagattgagaaaatcatgagctccattggggaagggattgacttc
tctcaggagcagcagaagatctcaggttctcggacgctggagcagagcgtcggggagtgg
ctggagtcgattggcctgcagcagtacgagagcaagctgctgctgaacggctttgatgat
gtccgcttcctggggtctaatgtgatggaagagcaggacctgagggagattggcatcagt
gacccacagcaccggcggaagctgctgcaggctgcacgctccttgcccaaggtgaaggcc
cttggctatgacggggtcagccccacctcagtgccctcatggctggactcgctggggctg
caggactatgtccactctttcctgtccagtggctacagctccatcgacactgtgaagaac
ctctgggagctagagcttgtcaatgtcctgaaagttcacctgctgggccaccgcaagcgc
attatcgcctctctagcagacaggccctatgaggagccaccccagaagcctccaaggttt
tcccagctaagatgccaggatttaatctcccagacatcgtccccgctgagccagaatgat
tcctgcacagggcggtcggcagacctgctgctgccctcagcagacacaagcaggaggcgg
cacgacagcctgcccgaccctgggaccgcctcccgagcagaccgcttccgagtccaggag
gagcccagtgagaccaagctgaccctccgtccacccagcctagccgcgccctatgctcct
gttcagagctggcagcaccagccagaaaagctcatctttgagtcctgcggttatgaggcc
aattatctgggttccatgctgatcaaagatctgcgagggacagagtccacccaagatgcc
tgtgccaaaatgcggaagtcaacggagcacatgaagaagatccccaccatcatcctgtcc
atcacgtacaaaggtgtcaagttcatcgatgcttccaacaagaacgtcattgcggagcac
gagatccggaacatttcctgcgccgcgcaggacccagaggacctgtgtaccttcgcgtac
atcaccaaggacctgcagacgagccaccactactgccacgttttcagcacagtggatgtg
aacctgacctacgagatcatcctgaccctggggcaggcatttgaggtggcctatcagctg
gccctccaagcccagaaatccaggaccatggcggcctctgcagcttcgatgattgagaca
aaatcctccaaaccagtgcctaagcctcgggtcggcatgaggaagtctgcactggaacca
cctgattctgaccaagaggccccgtcccacgctagtgtttcctggatcgtggacccaaag
ccagactcgaagcggagcctcagcaccaactga

DBGET integrated database retrieval system