KEGG   Mus musculus (house mouse): 224671
Entry
224671            CDS       T01002                                 
Symbol
Btbd9, 1700023F20Rik, 4930402L05, AI464421
Name
(RefSeq) BTB (POZ) domain containing 9
  KO
K10481  BTB/POZ domain-containing protein 9
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    224671 (Btbd9)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     224671 (Btbd9)
SSDB
Motif
Pfam: BTB BACK F5_F8_type_C SANBR_BTB DUF6472
Other DBs
NCBI-GeneID: 224671
NCBI-ProteinID: NP_081336
MGI: 1916625
Ensembl: ENSMUSG00000062202
UniProt: Q8C726
Position
17:complement(30434498..30801595)
AA seq 612 aa
MSNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKHFPAHRVILAARCQY
FRALLYGGMRESQPEAEIPLQDTTAEAFTMLLRYIYTGRATLTDEKEEVLLDFLSLAHKY
GFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLASDGFLS
LSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNAKENHAEIMQAVRLPLMSLTELLNVVR
PSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDT
QNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRLLLWDRDSRSYSYFIEVSMDELDW
IRVIDHSHYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKAFTLEKGL
IVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYI
IGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVG
THNTANEVFHCVHFECPEQQSNQKEDSSEEPGTGDPSTPNQQLDPHAPRAPSASSLPPSP
GPNSRSPNQQNQ
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgagtaacagccaccctcttcgcccctttactgcagtgggggaaatcgatcatgtgcac
attttgtctgagcatattggtgccttgttgattggtgaagaatatggtgatgtcacgttt
gttgtggaaaagaagcactttcctgcccacagggtaattttagcagcgaggtgccaatat
tttcgagcattactgtatggcgggatgcgagagtcgcagcccgaagcagagatccctctc
caagacaccacggccgaggctttcacgatgctcctcagatatatctacacggggcgggcg
acgctcactgatgagaaggaggaggtgctgctggacttcctgagcctggctcacaaatac
ggatttccagagctggaggactctacttctgagtatctctgcaccatactgaacattcag
aatgtctgtatgacctttgatgttgccagtctctactcgcttcccaagttaacttgtatg
tgctgcatgttcatggacagaaatgctcaggaggtgctggccagcgacggcttcctctcc
ctgtccaagacagcactcctgaatatcgtcttaagagattcgtttgctgctcctgagaaa
gatattttcttagccttgttaaactggtgtaagcacaatgcaaaagagaatcatgctgaa
atcatgcaggctgtgcgcttacctctaatgagcctcactgagcttctgaacgtcgtgagg
ccatcaggactcttgtctccggatgctattcttgatgccatcaaagtgcggtcggagagc
cgggatatggacctcaactacagaggcatgctcatacctgaagaaaacattgcaactatg
aagtatggggctcaggttgtgaaaggagagctgaagtcggccttgctggatggtgacact
caaaactatgacttggatcatggattttcccggcaccccattgatgatgactgccgctct
ggcattgagatcaagcttggccagccgtccattataaaccacatacgtctactcctgtgg
gaccgtgacagccggtcttattcctactttattgaagtgtccatggacgaacttgattgg
atcagagtgatcgatcactcacattacctgtgtcggtcttggcaaaagttgtatttccca
gcccgtgtctgcaggtatatccgaatagttgggactcacaacacagtgaacaagattttc
cacattgtggcttttgaatgcatgtttacaaacaaagccttcaccctggagaagggcctg
atagttcccctggagaatgtggcaacgatcgcagattgtgccagtgtgattgaaggagtc
agtcggagccggaatgccttgctgaatggggacactaagaattatgactgggactctggc
tacacgtgccaccagctgggcagtggtgccattgtggttcagctggcacagccatacata
attggctcaatacggttattactctgggactgcgatgatcgaagctacagctactatgtt
gaggtttccaccaatcagcagcagtggaccatggtggccgacagaacgaaagtgtcctgc
aagtcctggcagtcagtcacttttgaaagacagcctgcatccttcatccgaatcgtcggg
acacacaacacagcaaatgaggtgttccactgtgtccactttgagtgtccggagcagcag
agcaaccagaaggaggacagcagtgaggagccagggacaggggaccccagcacccccaat
cagcagctcgaccctcatgcaccacgggcacccagcgccagctcactaccaccgagtcca
ggccctaactcacgctcacccaaccaacagaaccaataa

DBGET integrated database retrieval system