KEGG   Mus musculus (mouse): 224703
Entry
224703            CDS       T01002                                 

Gene name
Marchf2, 9530046H09Rik, MARCH-II, March2
Definition
(RefSeq) membrane associated ring-CH-type finger 2
  KO
K10657  E3 ubiquitin-protein ligase MARCH2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    224703 (Marchf2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     224703 (Marchf2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   March proteins
    224703 (Marchf2)
SSDB
Motif
Pfam: RINGv Vpu zf-C3HC4 Baculo_IE-1 Wzy_C_2 zf-rbx1
Other DBs
NCBI-GeneID: 224703
NCBI-ProteinID: NP_001239409
MGI: 1925915
Ensembl: ENSMUSG00000079557
Vega: OTTMUSG00000037203
UniProt: Q99M02
Position
17; 17 B1
AA seq 246 aa
MTTGDCCHLPGSLCDCSSSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDSQSD
CPFCRICHEGANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPR
PLTEWLKDPGPRTEKRTLCCDMVCFVFITPLAAISGWLCLRGAQDHLRLHSRLEAVGLIA
LTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADGSEDPHHSLLATGLLKKV
AEETPV
NT seq 741 nt   +upstreamnt  +downstreamnt
atgacgacaggtgactgttgccacctccctggctccctatgtgactgttcgagcagccct
gccttttccaaggttgtagaggccacagggcttgggccacctcaatatgtagcacaagtg
acttcacgggatggccggctgctctcaactgtcatccgggctttggattcacagagtgac
tgtcccttctgccgaatctgccacgagggagcaaatggggagaacttgctgtccccatgt
ggctgcacgggcacactgggagctgtgcacaagagctgcctggagaaatggctgtcttcc
tccaacaccagctactgtgagctgtgtcacactgagtttgcagtggaaaagcggccccga
cctctcacagagtggctaaaggacccagggccgcgcactgagaagcgaacactgtgctgt
gacatggtgtgctttgtgttcatcacaccactggctgccatctcaggctggctttgcctg
cgaggggcccaggaccacctccgtctgcatagccggctggaagctgtaggtctcattgcc
ctcaccatcgccctctttaccatctatgtgctctggacactggtctctttccgataccat
tgccagctgtactcggaatggaggaagacaaatcagaaagtccgcctgaagattcgggaa
gcagatggctccgaggatccacatcactccttgctggctactggactcttaaaaaaggtg
gcagaggagacccctgtgtga

DBGET integrated database retrieval system