KEGG   Mus musculus (mouse): 224705
Entry
224705            CDS       T01002                                 

Gene name
Vps52, AR, ARE1, D130068D18, D430041K17Rik, SAC2, Sac, Sacm2l, tcl-w, tclw, tclw5
Definition
(RefSeq) VPS52 GARP complex subunit
  KO
K20298  vacuolar protein sorting-associated protein 52
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    224705 (Vps52)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Others
   EARP complex
    224705 (Vps52)
 Endosome - Golgi transport
  Tethering complex
   GARP complex
    224705 (Vps52)
SSDB
Motif
Pfam: Vps52 Sec3_C Dor1 COG6 COG2
Other DBs
NCBI-GeneID: 224705
NCBI-ProteinID: NP_766208
MGI: 1330304
Ensembl: ENSMUSG00000024319
Vega: OTTMUSG00000037086
UniProt: Q8C754
Position
17; 17 B1
AA seq 723 aa
MAAAATMAAAARELVLRAGASDVEEEEGPLGGGSGLQEPLQLGELDITSDEFILDEVDVH
IQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACD
AVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSA
LVTAILEAPVTEPRFLEQLQELDAKAAAVREQEAMGTAACADVRGVLDRLRVKAVTKIRE
FILQKIYSFRKPMTNYQIPQAALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYY
RSYVGRLMKVQYEEVAEKDDLMGVEDTAKKGFFSKPSLRSRNTIFTLGTRGTVISPAELE
APILVPHTAQRGEQRYPFEALFRSQHYALLDNSCREYLFICEFFIVSGPAAHDLFHAVMG
RTLSMTLKHLESYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRF
ELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEFSSALVSINQTIPNERTLQLLGQLQ
VEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEF
IEELLSPPFGGLVAFVKEAEALIERGQAERLRGEEARVTQLIRGFGSSWKASVESLSQDV
MRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHK
PNF
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggcagccgcagcgaccatggcggccgctgcccgggagctggtgttgcgggctggggcc
tcagatgtagaggaggaggagggcccgctgggggggggttctggactccaagaaccccta
caacttggagagttggacatcacctctgatgaattcatcttggatgaagtggatgttcac
atccaggcaaacctggaggatgagttagtgaaggaagctctcaaaacgggtgtggatctt
cgacactattcaaagcaggtggagctggagctgcagcagattgagcagaagtcaatccgg
gactatatccaagagagtgaaaacatagcgtctctgcacaatcagatcacggcctgtgac
gccgtcctggagcgcatggaacagatgctgggagcttttcagagcgatctcagctccatc
agctctgagatccgaaccctgcaggagcagtcgggggccatgaacatccgacttcgtaac
cgacaggcagttcgggggaaacttggggaacttgtggatgggctggtggtgccctctgct
ctggtcacagcaattctggaagctccagtgaccgagcccaggttcctggagcagctacag
gagctggatgccaaggcagccgcggtgagagagcaggaggctatgggcaccgctgcctgt
gctgacgtcagaggcgtgctggaccggctccgggtcaaggcagtgacgaagatccgggag
tttattctccagaagatctactccttcagaaagcccatgaccaactaccagatcccccag
gcggccctgctgaagtacaggtttttctatcagttcctgctgggtaatgagcgtgctaca
gccaaggagatcagggatgagtacgtagagacgctgagcaagatctacctgtcctactac
cgatcctatgtggggcggctcatgaaagtgcagtacgaggaagttgctgagaaagacgac
ctaatgggtgttgaagacacagcaaagaaaggcttcttctcgaagccgtccctccgaagc
aggaacaccatctttacccttggcactcgtggtactgtcatctcaccggccgagctggag
gcccccatcctagtgccccatactgcccaacgtggagagcagaggtatccattcgaagcg
ctcttccgcagccagcactatgccctcctcgacaattcttgccgtgaatatcttttcatc
tgtgaatttttcatcgtgtctggcccggctgcacatgacctgttccacgccgtcatgggc
cgcacgctctccatgacgctgaaacacctggagtcctacctggctgactgctacgatgcc
attgctgtttttctctgtatccacattgttctccggttccgcaacattgcagcgaagagg
gacgtccctgccctggacaggtactgggagcaggtgcttgccttgctgtggcctcggttt
gagctgatcctggagatgaatgtccagagtgtccgcagcactgacccccagcgccttggg
ggactggacactcggccccactatatcacacgccgctatgctgagttctcctctgcactt
gtcagcatcaaccagacgatccccaatgaacgcacgctgcagctcctgggacagctccag
gtggaggtggagaattttgtcctccgagtggctgcagagttctcctccaggaaggagcag
cttgtgtttctgatcaacaactatgacatgatgctcggggtgctgatggagcgggctgct
gatgacagcaaagaggtggaaagtttccagcagctgctcaatgctcggacacaggagttc
attgaggagctgctgtctccccccttcgggggtctggtggcattcgtgaaggaggctgaa
gccttgattgagcgtgggcaggctgagcggctccgaggggaggaagcccgagtcactcag
ctgatccgtggctttggtagttcctggaaggcatcagtggagtccctgagtcaggatgta
atgcgaagttttaccaacttccgaaatggaaccagcatcatccagggggcgctgacccag
ctgatccagctctaccatcgcttccaccgggtgctgtctcagccccagctccgcgcactc
ccggccagggccgagctcatcaacatccatcacctcatggtggagctgaagaaacacaag
ccgaacttctga

DBGET integrated database retrieval system