KEGG   Mus musculus (mouse): 224727
Entry
224727            CDS       T01002                                 

Gene name
Bag6, 2410045D21Rik, AA408914, BAG-6, Bat, Bat3, D17H6S52, D17H6S52E, G3, Scyth, Scythe
Definition
(RefSeq) BCL2-associated athanogene 6
  KO
K23390  large proline-rich protein BAG6
Organism
mmu  Mus musculus (mouse)
Brite
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   BAG6-UBL4A-GET4 complex
    224727 (Bag6)
SSDB
Motif
Pfam: BAG6 ubiquitin Rad60-SLD DUF2407 TBK1_ULD Rad60-SLD_2 Ubiquitin_5
Other DBs
NCBI-GeneID: 224727
NCBI-ProteinID: NP_476512
MGI: 1919439
Ensembl: ENSMUSG00000024392
Vega: OTTMUSG00000037183
UniProt: Q9Z1R2 Q3UF95
Position
17 B1; 17 18.59 cM
AA seq 1154 aa
MEPSDSASTAMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGAPLPGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMECRGGTQAQASQPPPQTPQTVASETVALNSQTSEPVESEAPPREPMESEEMEERPPT
QTPELAPSGPAPAGPAPAGPAPAPETNAPNHPSPAEHVEVLQELQRLQRRLQPFLQRYCE
VLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVR
PMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGARPPPAPGAEAATPGSAQATSLPPSSTT
VDSSTEGAPPPGPAPPPASSHPRVIRISHQSVEPVVMMHMNIQDSGAQPGGVPSAPTGPL
GPPGHGQTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGALQGAGLGTNTSLAQ
MVSGLVGQLLMQPVLVAQGTPGMAQAQAQAQAQAQAQAQAPAPAPAPAPAPATASASAGT
TNTATTAGPAPGGPAQPPPPQPSAADLQFSQLLGNLLGPAGPGAGGPGMASPTITVAMPG
VPAFLQGMTDFLQASQTAPPPPPPPPPPPPAPEQQSTPPPGSPSGGTASPGGLGPESLPP
EFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLL
CQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEY
VRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLA
LNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILR
YVRRVGDPPQTLPEEPMEVQGAERTSPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRD
EQDGASADAEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEG
PQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSP
QRFPNAHRAFADDP
NT seq 3465 nt   +upstreamnt  +downstreamnt
atggagccgagtgatagtgccagtaccgctatggaggagcctgacagcctggaggtactg
gtgaagaccctggactctcagactcggacttttattgtgggggcccagatgaatgtaaag
gagtttaaggaacacatagctgcctctgtcagcatcccttccgagaaacagcggctcatc
taccagggccgggtcctacaagacgacaagaagctccaggagtacaacgttgggggaaag
gttattcacctggtggaacgggctcctcctcagactcagcttccttctggagcatcttct
gggacaggctctgcctcagcaactcatggtggggcacccctgcctggcactcggggccct
ggggcttctgttcatgaccggaatgccaacagctatgtcatggttggaaccttcaatctt
cctagtgacggctctgctgtggatgttcacatcaacatggaacaggccccaattcagagt
gagccccgggtccggctggtgatggctcagcacatgattagggatatacagaccttactg
tcccggatggagtgtcgagggggaacccaagctcaggccagtcagccacccccgcagaca
ccgcagactgtggcctcagagacggtagccttgaactcacaaacatcagaaccagtcgaa
agtgaagctcctcctcgagagcccatggagtcagaagaaatggaggaacgtcccccaacc
cagactccagagcttgcgccctcaggcccagctcccgcaggcccagctcccgcaggccca
gctcccgcgccagagacaaatgcacccaaccacccttcccccgcagagcacgtggaggtg
ctccaggagcttcagcgcttgcagcgccgtcttcagcctttcctacagcgctactgcgag
gtcctgggcgctgctgccaccacagactacaacaacaaccatgagggccgtgaggaggac
cagaggttgatcaacttggttggggagagcctgcggctactgggcaacactttcgtggca
ttgtctgatctgcgctgcaatctagcctgtgcacccccacggcacctgcacgtggttcgg
cctatgtctcactacacgactcccatggtgctccagcaggcagccattcccattcagatc
aatgtggggactactgtgaccatgacaggcaatggggctcggcctccaccagctcctggt
gcggaggcagcaaccccaggttctgcccaggccacatccctgcctccctcttccaccact
gttgattcatcaactgaaggagctcccccaccagggccagcaccgccaccagcctccagc
cacccacgggtcatccggatttcccaccagagtgtggagcccgtggtcatgatgcacatg
aacattcaagattctggagcacagcctggtggtgtgccaagtgctcccactggtccactg
ggacctcctggtcatggacagaccctgggacagcaggtgcccggcttcccaacagcacca
actcgggtggtgattgcccggccaactcctccacaggctcggccttcccatcctggggga
cctccagtctctggagctctgcagggcgctgggctgggtacaaacacttcattggcccag
atggtgagcggccttgtggggcaacttcttatgcagcctgttcttgtggctcaggggact
ccaggaatggctcaggctcaggcccaggcccaggctcaggcccaggcccaggcccaggct
ccagctccggctccggctccagctccagctcctgccactgcttcagctagtgctggtact
accaacacagctaccacagctggccctgctcctgggggtcctgcccagcctccacctcct
cagccctctgcagctgatcttcagttctctcagctcctgggaaatctgctggggcctgca
gggccaggggctggggggccaggcatggcttctcccaccatcactgtggcaatgcctggt
gtccctgcttttctccagggcatgactgattttttgcaggcatcacagactgcccctcca
ccccctccacctcctccacccccaccccctgccccagagcagcagagcacacccccacca
gggtctccttctggtggaacagcaagccctggaggcttaggtcctgagagcctgccacca
gagtttttcacctcagtggtgcagggcgtgttgagctccctcctgggctccttgggggct
cgagctggcagcagtgagagtatcgctgccttcatccaacgcctcagtggatccagcaac
atctttgagcctggggctgatggcgcccttggattcttcggagctctgctctctctcctg
tgccagaatttctccatggtggatgtggtgatgcttctccatggccatttccagccactg
cagcggctccagccacagctgcgatctttcttccaccagcactacctgggtggccaggag
cccacgcctagcaacatccggatggcgacccacacactgatcactgggctggaagagtat
gtaagggagagtttttctttggtacaggttcagccaggtgtggatatcatccggacaaat
ttagaatttctccaagagcagtttaacagcattgctgctcatgtgctgcactgtacagac
agtggatttggagcccggttgctggagctgtgtaaccagggcctgtttgaatgcttggcc
ctgaacctccactgcttggggggacagcaaatggagcttgctgctgtcatcaatggtcga
attcgccgcatgtctcgcggggtgaatccatccttggtgagctggctgacaaccatgatg
ggactgaggcttcaggtggtcttggagcacatgcctgtgggtcccgacgccatcctcaga
tatgttcgtagggttggtgatcctcctcagacacttcctgaagagccgatggaagttcag
ggagcagaaagaacttcccctgaacctcagagagagaatgcttccccagcccctggaaca
acagcagaagaagccatgtcccgaggcccgccccctgctcctgaaggaggttcccgagat
gaacaggatggagcttcagctgatgcagaaccctgggcagctgcagtcccccctgaatgg
gtccctattatccagcaggacattcagagccagcggaaggtgaaacctcagccgcccctg
agtgatgcctacctcagtggcatgcctgccaagagacgaaagacaatgcagggtgagggc
ccccagctgctactctcagaggcagtgagccgggcagctaaggcagccggagctcggccc
ctgacaagccccgagagcctgagccgggacctggaggcaccagaggttcaggagagctac
aggcagcagctccggtctgatatccaaaaacgactgcaggaagatcccaactacagcccc
cagcgcttccctaatgcccatcgggcatttgctgatgacccctag

DBGET integrated database retrieval system