KEGG   Mus musculus (mouse): 224762Help
Entry
224762            CDS       T01002                                 

Gene name
Trim31, BC026666, HCG1, HCGI, RNF
Definition
(RefSeq) tripartite motif-containing 31
  KO
K12011  tripartite motif-containing protein 31 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     224762 (Trim31)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    224762 (Trim31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_4 zf-RING_UBOX zf-C3HC4 zf-C3HC4_2 zf-B_box zf-C3HC4_3 SPRY zf-RING_2 zf-RING_5 PRY zf-RING_10 zf-rbx1 zf-RING_6 Prok-RING_4 zf-Nse P4Ha_N U-box DZR zf-RING_4
Motif
Other DBs
NCBI-GeneID: 224762
NCBI-ProteinID: NP_666189
MGI: 2385051
Ensembl: ENSMUSG00000058063
Vega: OTTMUSG00000037382
UniProt: Q8R0K2
Position
17; 17 B1
AA seq 507 aa AA seqDB search
MAGQPLACQLQEEVTCPICMEILQDPVTIDCGHNFCLQCISQVGKTSEKIQCPLCKLSVN
KNTFRPNKLLASLAEKIQSMDPADIQAEKEDSRCQRHKEKLHYFCEQDGAFLCVVCRDSK
DHKSHNVTLIDEAAQNYKVQIESQAQDLGQKDKKIIEEKKQGEGAIWAFRAQVDLEKLKI
HEEFKLLRQRLDEEESFLLSRLDWLEQQGAKQLRQYVTVTEKQLNSLRKLTKSLKIRLQS
SSMELLKDIKDALSRGKEFQFLNPNPVPEDLEKKCSEAKARHESIIKTLTELKDDMNAEG
KRDKSAFMNSLNKEEKESWSLLQKNNSVLPTSVPVTLDKSSADPDLTFSQDLKKVTLYIV
AGKASNRQAKPRPFYPFHCVRGSPGLSSGRQVWEAEIRGPSGGACIVGVVTELARGAQSQ
TVSAQSYIWALRISPSGCQPFTNCKAQEYLQVCLKKVGVYVNHDCGEVVFYDAITSKHIY
TFQTSFDGKVFPLFGLQVACSHITLSP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcaggccaacctctggcctgccaactgcaggaggaggtgacctgccccatctgcatg
gaaattctacaagatcctgtcaccattgactgtgggcacaacttctgcctgcagtgtatc
agtcaggttggaaaaacgtcagaaaagatccaatgtcctctctgcaaactctctgtgaat
aagaatacgttcaggcccaataagctgctggctagtcttgcagagaagatccaaagtatg
gatcctgctgacatccaagcagaaaaggaagactcaagatgtcagaggcacaaggaaaag
ctacattacttctgcgagcaggatggggcattcctctgtgtggtgtgtcgtgactccaag
gaccacaagtctcacaatgtcaccttgatagatgaggctgcccagaactacaaggtgcag
attgagtcacaggcccaagatttggggcaaaaggacaagaaaataattgaagagaaaaaa
caaggtgaaggggcaatctgggcgttcagggcccaggtggatctagagaaactaaagatc
catgaggaattcaagctcctgcgccagagactagatgaggaagagagtttcctcctgtcc
aggctggactggctggagcagcagggagccaagcagttgagacaatatgtcactgtgaca
gagaagcagctgaactctctaaggaagctcactaaatccttgaaaataaggctgcaatca
tcatccatggagctactaaaggacattaaagacgccttgagcaggggtaaggaatttcag
tttctcaacccaaacccagttcctgaggacctggagaaaaaatgcagtgaagcaaaagca
aggcatgagtccatcataaaaaccctgacagaactcaaagacgatatgaatgccgaaggg
aagagagataaaagcgcattcatgaacagcctgaataaagaagaaaaggagagctggagc
ctgttacagaagaataattcagtgttgcccacctcagtccctgtgaccctggacaagtcc
tcagctgacccagacctcaccttttctcaggatctaaagaaagtgaccttgtatattgta
gctggaaaagcttccaataggcaggcaaaacctcgaccattctaccctttccactgtgtg
aggggttccccaggcctctcctcaggccgccaggtgtgggaggcagaaatccgggggccc
tcaggtggggcatgcattgtgggcgtggttacagagttggcgcgaggggcccagagtcaa
accgtgagcgcgcagagctacatatgggcactgcggatctcgccctctggatgccagcca
ttcaccaattgtaaagcccaggagtacctccaggtctgtcttaagaaagtgggtgtctat
gtgaatcatgactgtggagaggtcgtcttctatgatgccatcactagcaaacacatctat
actttccaaacttcctttgacgggaaggtcttcccccttttcgggctccaagttgcctgc
agccatatcaccctgagcccttag

DBGET integrated database retrieval system